| UniProt ID | MFA2_YEAST | |
|---|---|---|
| UniProt AC | P34166 | |
| Protein Name | Mating hormone A-factor 2 | |
| Gene Name | MFA2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 38 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . |
|
| Protein Description | The active factor is excreted into the culture medium by haploid cells of the A mating type and acts on cells of the opposite mating type (type alpha). It mediates the conjugation process between the two types by inhibiting the initiation of DNA synthesis in type alpha cells and synchronizing them with type A.. | |
| Protein Sequence | MQPITTASTQATQKDKSSEKKDNYIIKGLFWDPACVIA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 35 | Methylation | GLFWDPACVIA---- EEEECCCCEEC---- | 2.50 | 3056940 | |
| 35 | Farnesylation | GLFWDPACVIA---- EEEECCCCEEC---- | 2.50 | 3056940 | |
| 35 | Farnesylation | GLFWDPACVIA---- EEEECCCCEEC---- | 2.50 | 3056940 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MFA2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MFA2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MFA2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Methylation | |
| Reference | PubMed |
| "Structure of Saccharomyces cerevisiae mating hormone a-factor.Identification of S-farnesyl cysteine as a structural component."; Anderegg R.J., Betz R., Carr S.A., Crabb J.W., Duntze W.; J. Biol. Chem. 263:18236-18240(1988). Cited for: ISOPRENYLATION AT CYS-35, AND METHYLATION AT CYS-35. | |
| Prenylation | |
| Reference | PubMed |
| "Structure of Saccharomyces cerevisiae mating hormone a-factor.Identification of S-farnesyl cysteine as a structural component."; Anderegg R.J., Betz R., Carr S.A., Crabb J.W., Duntze W.; J. Biol. Chem. 263:18236-18240(1988). Cited for: ISOPRENYLATION AT CYS-35, AND METHYLATION AT CYS-35. | |