dbPTM

SET6_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SET6_YEAST
UniProt AC	Q12529
Protein Name	Potential protein lysine methyltransferase SET6
Gene Name	SET6
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	373
Subcellular Localization
Protein Description	Involved in resistance to compounds that target ergosterol biosynthesis, including fenpropimorph, dyclonine, and alverine citrate. Since a deletion in the absence of these compounds does not have an effect on growth, is more likely to be involved in compound availability..
Protein Sequence	MTIDGDVHEISPFFQVRQTKWGGRACFSNGNIPKGTTVLQVSNFTGTSISYEFRKEVCHNCFAYANAKTMKYKLNYDYLRDLVCNAHYQINPKKFLGAGLWFCSEHCRTSYLQIPNIIELIECYEILLHHFPSMLKRYNYTSEQEEKLNSILISENVIQSSWDEIESKWIPRINNMKSAKRINQLPPTCEDEYCCIRFVCESLFNLKYMDPQCITYRAFNMLQSNELSKISKFPVLLHFQKLVFQTLYILLPSHLHRMLSIPLLRHILGTEYGNAFGLWQEGEASDSREYFGYWVFPEASYFNHSCNPNITKYRKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFFDCACERCKSELQSVH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of SET6_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SET6_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SET6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SET6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MED16_YEAST	SIN4	genetic	17314980
VPH2_YEAST	VPH2	genetic	17314980
UME1_YEAST	UME1	genetic	17314980
RIC1_YEAST	RIC1	genetic	17314980
SSF1_YEAST	SSF1	genetic	17314980
COPE_YEAST	SEC28	genetic	17314980
TBF1_YEAST	TBF1	genetic	17314980
HSP71_YEAST	SSA1	physical	19536198
YMC2_YEAST	YMC2	genetic	20093466
DCC1_YEAST	DCC1	genetic	20093466
RV167_YEAST	RVS167	genetic	20093466
PP2C2_YEAST	PTC2	genetic	20093466
DBF2_YEAST	DBF2	genetic	20093466
IGO2_YEAST	IGO2	genetic	20093466
CTF8_YEAST	CTF8	genetic	20093466
MRT4_YEAST	MRT4	genetic	20093466
JNM1_YEAST	JNM1	genetic	20093466
RS7B_YEAST	RPS7B	genetic	20093466
DIA2_YEAST	DIA2	genetic	20093466
VPH1_YEAST	VPH1	genetic	20093466
MDM10_YEAST	MDM10	genetic	27708008
NU170_YEAST	NUP170	genetic	27708008
YMC2_YEAST	YMC2	genetic	27708008
PP2C2_YEAST	PTC2	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
RTG2_YEAST	RTG2	genetic	27708008
DBF2_YEAST	DBF2	genetic	27708008
VPS35_YEAST	VPS35	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
UPS1_YEAST	UPS1	genetic	27708008
UBX2_YEAST	UBX2	genetic	27708008
MKS1_YEAST	MKS1	genetic	27708008
RS7B_YEAST	RPS7B	genetic	27708008
RTG1_YEAST	RTG1	genetic	27708008
DIA2_YEAST	DIA2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SET6_YEAST

Related Literatures of Post-Translational Modification