| UniProt ID | TPC1_YEAST | |
|---|---|---|
| UniProt AC | P53257 | |
| Protein Name | Mitochondrial thiamine pyrophosphate carrier 1 | |
| Gene Name | TPC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 314 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Mitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria.. | |
| Protein Sequence | MFKEEDSLRKGQNVAAWKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQVMEVARSMIKNEGIRSFWKGNIPGSLLYVTYGSAQFSSYSLFNRYLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQMHSMSITREVRDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKWELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQILKQEGVSSLYRGILVALSKTIPTTFVSFWGYETAIHYLRMY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 171 | Phosphorylation | LPGFFKGSIASMTTI CCCCCCCCHHHCEEE | 18.64 | 28889911 | |
| 174 | Phosphorylation | FFKGSIASMTTITLT CCCCCHHHCEEEEEE | 18.26 | 28889911 | |
| 181 | Phosphorylation | SMTTITLTASIMFGT HCEEEEEEEEHHHCC | 15.09 | 28889911 | |
| 188 | Phosphorylation | TASIMFGTYETIRIY EEEHHHCCCEEEEEE | 13.61 | 28889911 | |
| 189 | Phosphorylation | ASIMFGTYETIRIYC EEHHHCCCEEEEEEE | 16.08 | 28889911 | |
| 191 | Phosphorylation | IMFGTYETIRIYCDE HHHCCCEEEEEEECC | 12.73 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPC1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MSH2_YEAST | MSH2 | physical | 18467557 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| CDC24_YEAST | CDC24 | genetic | 27708008 | |
| GPI11_YEAST | GPI11 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| CDC20_YEAST | CDC20 | genetic | 27708008 | |
| ATC7_YEAST | NEO1 | genetic | 27708008 | |
| PRP24_YEAST | PRP24 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
