MED19_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MED19_YEAST
• UniProt AC: P25046
• Protein Name: Mediator of RNA polymerase II transcription subunit 19
• Gene Name: ROX3
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 220
• Subcellular Localization: Nucleus .
• Protein Description: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. The Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins..
• Protein Sequence: MASRVDETTVPSYYYYVDPETTYTYQQPNPLQDLISVYGLDDISRQVARTNLDGTKAVKLRKSYKNQIADLSGKFSTIPTRENGKGGQIAHILFQNNPDMMIQPPQQGQNMSEQQWREQLRNRDIALFQPPNFDWDLCSSVLSQFERSYPSEFANQNQGGAQAPFDIDDLAFDLDGTGKSQSGSNSGNNSKKRKNKSSGSSMATPTHSDSHEDMKRRRLE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
72	Phosphorylation	KNQIADLSGKFSTIP HHHHHHHCCCCCCCC	40.25	27017623
76	Phosphorylation	ADLSGKFSTIPTREN HHHCCCCCCCCCCCC	28.98	27017623
197	Phosphorylation	SKKRKNKSSGSSMAT CCCCCCCCCCCCCCC	49.69	20377248
198	Phosphorylation	KKRKNKSSGSSMATP CCCCCCCCCCCCCCC	44.28	20377248
200	Phosphorylation	RKNKSSGSSMATPTH CCCCCCCCCCCCCCC	20.91	22369663
201	Phosphorylation	KNKSSGSSMATPTHS CCCCCCCCCCCCCCC	18.89	20377248
204	Phosphorylation	SSGSSMATPTHSDSH CCCCCCCCCCCCCCH	21.78	22369663
206	Phosphorylation	GSSMATPTHSDSHED CCCCCCCCCCCCHHH	29.65	22369663
208	Phosphorylation	SMATPTHSDSHEDMK CCCCCCCCCCHHHHH	43.20	20377248
210	Phosphorylation	ATPTHSDSHEDMKRR CCCCCCCCHHHHHHH	31.61	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MED19_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MED19_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MED19_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MED9_YEAST	CSE2	physical	11805826
MED15_YEAST	GAL11	physical	11805826
MED1_YEAST	MED1	physical	11805826
MED11_YEAST	MED11	physical	11805826
MED4_YEAST	MED4	physical	11805826
MED6_YEAST	MED6	physical	11805826
MED7_YEAST	MED7	physical	11805826
MED8_YEAST	MED8	physical	11805826
RM06_YEAST	MRPL6	physical	11805826
MED5_YEAST	NUT1	physical	11805826
MED10_YEAST	NUT2	physical	11805826
MED3_YEAST	PGD1	physical	11805826
MED14_YEAST	RGR1	physical	11805826
MED16_YEAST	SIN4	physical	11805826
MED20_YEAST	SRB2	physical	11805826
MED17_YEAST	SRB4	physical	11805826
MED18_YEAST	SRB5	physical	11805826
MED21_YEAST	SRB7	physical	11805826
SRB8_YEAST	SRB8	physical	11805826
SSN2_YEAST	SSN2	physical	11805826
SSN3_YEAST	SSN3	physical	11805826
AP1_YEAST	YAP1	physical	11805826
MED8_YEAST	MED8	physical	16554755
MED22_YEAST	SRB6	physical	16554755
MED2_YEAST	MED2	physical	16554755
MED21_YEAST	SRB7	physical	16554755
YRA1_YEAST	YRA1	physical	16554755
MED17_YEAST	SRB4	physical	16554755
MED3_YEAST	PGD1	physical	16554755
MED31_YEAST	SOH1	physical	16554755
YPP1_YEAST	YPP1	physical	16554755
MED6_YEAST	MED6	physical	16554755
LSM12_YEAST	LSM12	physical	16554755
STM1_YEAST	STM1	physical	16554755
MED9_YEAST	CSE2	physical	16554755
MED15_YEAST	GAL11	physical	16554755
MED4_YEAST	MED4	physical	16554755
MED1_YEAST	MED1	physical	16554755
MED10_YEAST	NUT2	physical	16554755
AP1_YEAST	YAP1	physical	16219769
2A5D_YEAST	RTS1	genetic	8846889
SFL1_YEAST	SFL1	genetic	9755175

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.