UniProt ID | DPH6_YEAST | |
---|---|---|
UniProt AC | Q12429 | |
Protein Name | Diphthine--ammonia ligase | |
Gene Name | DPH6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 685 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Amidase that catalyzes the last step of diphthamide biosynthesis using ammonium and ATP. Diphthamide biosynthesis consists in the conversion of an L-histidine residue in the translation elongation factor eEF-2 (EFT1 or EFT2) to diphthamide.. | |
Protein Sequence | MKFIALISGGKDSFYNIFHCLKNNHELIALGNIYPKESEEQELDSFMFQTVGHDLIDYYSKCIGVPLFRRSILRNTSNNVELNYTATQDDEIEELFELLRTVKDKIPDLEAVSVGAILSSYQRTRVENVCSRLGLVVLSYLWQRDQAELMGEMCLMSKDVNNVENDTNSGNKFDARIIKVAAIGLNEKHLGMSLPMMQPVLQKLNQLYQVHICGEGGEFETMVLDAPFFQHGYLELIDIVKCSDGEVHNARLKVKFQPRNLSKSFLLNQLDQLPVPSIFGNNWQDLTQNLPKQQAKTGEQRFENHMSNALPQTTINKTNDKLYISNLQSRKSETVEKQSEDIFTELADILHSNQIPRNHILSASLLIRDMSNFGKINKIYNEFLDLSKYGPLPPSRACVGSKCLPEDCHVQLSVVVDVKNTGKEKINKNKGGLHVQGRSYWAPCNIGPYSQSTWLNDDANQVSFISGQIGLVPQSMEILGTPLTDQIVLALQHFDTLCETIGAQEKLLMTCYISDESVLDSVIKTWAFYCSNMNHRSDLWMDKSDDVEKCLVLVKISELPRGAVAEFGGVTCKRLIVDDNDSDKKEREENDDVSTVFQKLNLNIEGFHNTTVSAFGYNRNFITGFVDSREELELILEKTPKSAQITLYYNPKEIITFHHHIGYYPVEKLFDYRGKEHRFGLHIRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DPH6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DPH6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DPH6_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALDH2_YEAST | ALD2 | physical | 16554755 | |
EF2_YEAST | EFT2 | physical | 23468660 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
RS8A_YEAST | RPS8A | genetic | 27708008 | |
RS8B_YEAST | RPS8A | genetic | 27708008 | |
RLA4_YEAST | RPP2B | genetic | 27708008 | |
EF2_YEAST | EFT2 | genetic | 27708008 | |
TFS2_YEAST | DST1 | genetic | 27708008 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
CYP7_YEAST | CPR7 | genetic | 27708008 | |
SST2_YEAST | SST2 | genetic | 27708008 | |
SRC1_YEAST | SRC1 | genetic | 27708008 | |
GGPPS_YEAST | BTS1 | genetic | 27708008 | |
AXL1_YEAST | AXL1 | genetic | 27708008 | |
PMP1_YEAST | PMP1 | physical | 26404137 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...