| UniProt ID | PFD1_YEAST | |
|---|---|---|
| UniProt AC | P46988 | |
| Protein Name | Prefoldin subunit 1 | |
| Gene Name | PFD1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 109 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.. | |
| Protein Sequence | MSQIAQEMTVSLRNARTQLDMVNQQLAYLDRQEKLAELTKKELESYPTDKVWRSCGKSFILQDKSKYVNDLSHDETVLLDQRKTLKIKKNYLETTVEKTIDNLKALMKN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSQIAQEMT ------CCHHHHHHH | 30.23 | 22814378 | |
| 2 | Phosphorylation | ------MSQIAQEMT ------CCHHHHHHH | 30.23 | 23607784 | |
| 9 | Phosphorylation | SQIAQEMTVSLRNAR CHHHHHHHHHHHHHH | 13.24 | 28132839 | |
| 11 | Phosphorylation | IAQEMTVSLRNARTQ HHHHHHHHHHHHHHH | 16.67 | 23607784 | |
| 17 | Phosphorylation | VSLRNARTQLDMVNQ HHHHHHHHHHHHHHH | 30.95 | 27017623 | |
| 50 | Acetylation | LESYPTDKVWRSCGK HHCCCCHHHHHHCCC | 46.29 | 24489116 | |
| 91 | Phosphorylation | TLKIKKNYLETTVEK HHHHHHHHHHHHHHH | 18.13 | 28132839 | |
| 98 | Acetylation | YLETTVEKTIDNLKA HHHHHHHHHHHHHHH | 46.58 | 24489116 | |
| 99 | Phosphorylation | LETTVEKTIDNLKAL HHHHHHHHHHHHHHH | 21.76 | 21126336 | |
| 104 | Acetylation | EKTIDNLKALMKN-- HHHHHHHHHHHCC-- | 45.81 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
