UniProt ID | GNT1_YEAST | |
---|---|---|
UniProt AC | Q12096 | |
Protein Name | Glucose N-acetyltransferase 1 | |
Gene Name | GNT1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 491 | |
Subcellular Localization |
Golgi apparatus membrane Single-pass type II membrane protein . Vacuole membrane Single-pass type II membrane protein . |
|
Protein Description | N-acetylglucosaminyltransferase involved in the Golgi-specific modification of N-linked glycans.. | |
Protein Sequence | MRLISKRRIRFIVFILFGVLTVFVVSRLVVHFQYNQEIKFYKKYFQQRKDGLHEIYNPLEIKQIPKETIDDLYTARLDKELKNGEVIEWSKFAYVNYVTNADYLCNTLIIFNDLKQEFETKAKLVLLISKDLLDPNTSSNVAYISSLLNKIQAIDEDQVVIKLIDNIVKPKDTTPWNESLTKLLVFNQTEFDRVIYLDNDAILRSSLDELFFLPNYIKFAAPLTYWFLSNSDLEKSYHETRHREKQPINLQSYTKVLTKRIGKGQMIYNHLPSLPHSLYLNSNNIAQDIISSTSSLSPLFDFQSSKKVGKLKFASNLMVINPSKEAFDEIVNVMLPKILNKKEKYDMDLINEEMYNLKKIIYKQFIFFRKVRKLFKPEVLVLPFARYGLLTGSLRNPRHYSIIYNDVLGYKTLDNDGNDIPVGLNDSVAYSKYIHFSDYPLAKPWNYPSMKEFECIVKEEDAEDSKLEHQACDLWNSVYASYIQSREICLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
136 | N-linked_Glycosylation | SKDLLDPNTSSNVAY EHHHCCCCCCCCHHH | 52.86 | - | |
177 | N-linked_Glycosylation | PKDTTPWNESLTKLL CCCCCCCCHHHHHHH | 30.13 | - | |
187 | N-linked_Glycosylation | LTKLLVFNQTEFDRV HHHHHEECCCCCCEE | 40.14 | - | |
245 | Acetylation | HETRHREKQPINLQS HHHCCCCCCCCCHHH | 62.42 | 24489116 | |
425 | N-linked_Glycosylation | NDIPVGLNDSVAYSK CCCCCCCCCCCCCCC | 33.32 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNT1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNT1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNT1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...