dbPTM

MGR3L_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MGR3L_YEAST
UniProt AC	P36066
Protein Name	Protein MRG3-like
Gene Name	YKL133C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	463
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGIVSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENVDLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRDLQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFKGLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGALNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELIRSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINLHKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
159	Phosphorylation	GDMLKKFYNELSKTT HHHHHHHHHHHHCCC	19.33	27017623
163	Phosphorylation	KKFYNELSKTTDKST HHHHHHHHCCCCCCH	23.06	27017623
224	Phosphorylation	PEFKNVLSKSELLNN HHHHHHCCHHHHHCC	29.83	15665377

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MGR3L_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MGR3L_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MGR3L_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPC72_YEAST	SPC72	physical	22875988
ETP1_YEAST	ETP1	physical	22875988
VPS41_YEAST	VPS41	genetic	27708008
LTE1_YEAST	LTE1	genetic	27708008
BAP3_YEAST	BAP3	genetic	27708008
CYP7_YEAST	CPR7	genetic	27708008
SIC1_YEAST	SIC1	genetic	27708008
NKP2_YEAST	NKP2	genetic	27708008
AIM44_YEAST	AIM44	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MGR3L_YEAST

Related Literatures of Post-Translational Modification