UniProt ID | CYC7_YEAST | |
---|---|---|
UniProt AC | P00045 | |
Protein Name | Cytochrome c iso-2 | |
Gene Name | CYC7 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 113 | |
Subcellular Localization | Mitochondrion intermembrane space . | |
Protein Description | Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.. | |
Protein Sequence | MAKESTGFKPGSAKKGATLFKTRCQQCHTIEEGGPNKVGPNLHGIFGRHSGQVKGYSYTDANINKNVKWDEDSMSEYLTNPKKYIPGTKMAFAGLKKEKDRNDLITYMTKAAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Ubiquitination | AKESTGFKPGSAKKG CCCCCCCCCCCCCCC | 50.22 | - | |
12 | Phosphorylation | STGFKPGSAKKGATL CCCCCCCCCCCCCEE | 45.50 | 27717283 | |
14 | Ubiquitination | GFKPGSAKKGATLFK CCCCCCCCCCCEEEE | 54.13 | - | |
65 | 2-Hydroxyisobutyrylation | YTDANINKNVKWDED EECCCCCCCCCCCCC | 60.36 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYC7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYC7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYC7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
URE2_YEAST | URE2 | physical | 18467557 | |
DBP3_YEAST | DBP3 | physical | 18467557 | |
COX14_YEAST | COX14 | genetic | 23897805 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...