UniProt ID | TIM9_YEAST | |
---|---|---|
UniProt AC | O74700 | |
Protein Name | Mitochondrial import inner membrane translocase subunit TIM9 | |
Gene Name | TIM9 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 87 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein Intermembrane side . Mitochondrion intermembrane space . |
|
Protein Description | Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Compared to TIM10, it may have a strong structural role.. | |
Protein Sequence | MDALNSKEQQEFQKVVEQKQMKDFMRLYSNLVERCFTDCVNDFTTSKLTNKEQTCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDALNSKE -------CCCCCHHH | 6.49 | 22814378 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM9_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM9_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM9_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIM10_YEAST | TIM10 | physical | 12138093 | |
TIM10_YEAST | TIM10 | physical | 11483513 | |
TIM10_YEAST | TIM10 | physical | 9822593 | |
TIM10_YEAST | TIM10 | physical | 11867522 | |
SPT7_YEAST | SPT7 | genetic | 12923659 | |
TIM10_YEAST | TIM10 | physical | 16039669 | |
TIM10_YEAST | TIM10 | physical | 18022191 | |
TIM9_YEAST | TIM9 | physical | 18022191 | |
TIM9_YEAST | TIM9 | physical | 12138093 | |
TIM10_YEAST | TIM10 | physical | 19667201 | |
MIA40_YEAST | MIA40 | physical | 19667201 | |
TIM22_YEAST | TIM22 | physical | 19667201 | |
TIM10_YEAST | TIM10 | physical | 18270693 | |
TIM10_YEAST | TIM10 | physical | 18421298 | |
MIA40_YEAST | MIA40 | physical | 17978092 | |
TIM10_YEAST | TIM10 | physical | 17978092 | |
MIA40_YEAST | MIA40 | physical | 21944719 | |
TIM10_YEAST | TIM10 | physical | 21944719 | |
TIM12_YEAST | TIM12 | physical | 21944719 | |
TIM18_YEAST | TIM18 | physical | 21944719 | |
TIM22_YEAST | TIM22 | physical | 21944719 | |
TIM54_YEAST | TIM54 | physical | 21944719 | |
YME1_YEAST | YME1 | genetic | 23036860 | |
TIM10_YEAST | TIM10 | physical | 22095685 | |
YME1_YEAST | YME1 | genetic | 26182355 | |
TIM10_YEAST | TIM10 | physical | 26182355 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...