UniProt ID | TIM12_YEAST | |
---|---|---|
UniProt AC | P32830 | |
Protein Name | Mitochondrial import inner membrane translocase subunit TIM12 | |
Gene Name | TIM12 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 109 | |
Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . Mitochondrion intermembrane space . |
|
Protein Description | Essential component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex forms a twin-pore translocase that uses the membrane potential as external driving force. In the TIM22 complex, it acts as a docking point for the soluble TIM9-TIM10 heterohexamer that guides the target proteins in transit through the aqueous mitochondrial intermembrane space.. | |
Protein Sequence | MSFFLNSLRGNQEVSQEKLDVAGVQFDAMCSTFNNILSTCLEKCIPHEGFGEPDLTKGEQCCIDRCVAKMHYSNRLIGGFVQTRGFGPENQLRHYSRFVAKEIADDSKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSFFLNSLR ------CCHHHHHHC | 25.38 | 22814378 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM12_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM12_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM12_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TIM10_YEAST | TIM10 | physical | 9495346 | |
TIM22_YEAST | TIM22 | physical | 9495346 | |
TIM18_YEAST | TIM18 | physical | 10648604 | |
TIM22_YEAST | TIM22 | physical | 11509656 | |
TIM54_YEAST | TIM54 | physical | 11509656 | |
TIM54_YEAST | TIM54 | physical | 10648604 | |
SPT7_YEAST | SPT7 | genetic | 12923659 | |
TIM9_YEAST | TIM9 | genetic | 9822593 | |
TIM12_YEAST | TIM12 | physical | 17627602 | |
TIM9_YEAST | TIM9 | physical | 17627602 | |
CYB2_YEAST | CYB2 | genetic | 20026652 | |
MIA40_YEAST | MIA40 | physical | 18421298 | |
SLK19_YEAST | SLK19 | physical | 22940862 | |
MIA40_YEAST | MIA40 | physical | 22918950 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...