UniProt ID | DDT4L_HUMAN | |
---|---|---|
UniProt AC | Q96D03 | |
Protein Name | DNA damage-inducible transcript 4-like protein | |
Gene Name | DDIT4L | |
Organism | Homo sapiens (Human). | |
Sequence Length | 193 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.. | |
Protein Sequence | MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
83 | Acetylation | SKVLVPEKLTQRIAQ CCEECCHHHHHHHHH | 51.25 | 156565 | |
98 | Phosphorylation | DVLRLSSTEPCGLRG HHHHHCCCCCCCCCC | 40.34 | 30257219 | |
146 | Phosphorylation | VFKQENCSWTSFRDF EEECCCCCCEEHHHH | 44.99 | 29083192 | |
148 | Phosphorylation | KQENCSWTSFRDFFF ECCCCCCEEHHHHHH | 11.16 | 29083192 | |
149 | Phosphorylation | QENCSWTSFRDFFFS CCCCCCEEHHHHHHC | 16.42 | 29083192 | |
156 | Phosphorylation | SFRDFFFSRGRFSSG EHHHHHHCCCCCCCC | 28.77 | 29083192 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DDT4L_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DDT4L_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DDT4L_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LRC15_HUMAN | LRRC15 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...