| UniProt ID | SPI1_YEAST | |
|---|---|---|
| UniProt AC | P40092 | |
| Protein Name | Uncharacterized cell wall protein SPI1 | |
| Gene Name | SPI1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 148 | |
| Subcellular Localization |
Secreted, cell wall. Membrane Lipid-anchor, GPI-anchor. Covalently-linked GPI-modified cell wall protein (GPI-CWP). |
|
| Protein Description | Cell wall protein that plays a role in adaptation and resistance to cell wall stress.. | |
| Protein Sequence | MLSNAKLLLSLAMASTALGLVSNSSSSVIVVPSSDATIAGNDTATPAPEPSSAAPIFYNSTATATQYEVVSEFTTYCPEPTTFVTNGATFTVTAPTTLTITNCPCTIEKPTSETSVSSTHDVETNSNAANARAIPGALGLAGAVMMLL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 41 | N-linked_Glycosylation | SDATIAGNDTATPAP CCCEECCCCCCCCCC | 34.14 | - | |
| 59 | N-linked_Glycosylation | SAAPIFYNSTATATQ CCCCEEECCCCCCEE | 23.33 | - | |
| 127 | GPI-anchor | HDVETNSNAANARAI CCCCCCCCHHHHHHH | 45.18 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPI1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPI1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPI1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GET3_YEAST | GET3 | physical | 18719252 | |
| DEP1_YEAST | DEP1 | genetic | 20093466 | |
| MDM10_YEAST | MDM10 | genetic | 20093466 | |
| ARF1_YEAST | ARF1 | genetic | 20093466 | |
| SRF1_YEAST | SRF1 | genetic | 20093466 | |
| YD131_YEAST | YDR131C | genetic | 20093466 | |
| ZRT1_YEAST | ZRT1 | genetic | 20093466 | |
| MED5_YEAST | NUT1 | genetic | 20093466 | |
| SMA2_YEAST | SMA2 | genetic | 20093466 | |
| BUB3_YEAST | BUB3 | genetic | 20093466 | |
| SLG1_YEAST | SLG1 | genetic | 23891562 | |
| PRY2_YEAST | PRY2 | genetic | 23891562 | |
| UBQL1_HUMAN | UBQLN1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
