RRP46_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RRP46_YEAST
• UniProt AC: P53256
• Protein Name: Exosome complex component RRP46
• Gene Name: RRP46
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 223
• Subcellular Localization: Cytoplasm . Nucleus, nucleolus .
• Protein Description: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. RRP46 is part of the hexameric ring of RNase PH domain-containing subunits proposed to form a central channel which threads RNA substrates for degradation..
• Protein Sequence: MSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Ubiquitination	VTGPIEPKARQELPT ECCCCCHHHHCCCCH	43.33	23749301
218	Phosphorylation	RIIQDNISPRLVV-- HHHHCCCCCCCCC--	15.38	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RRP46_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RRP46_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RRP46_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RRP44_YEAST	DIS3	physical	14759368
RRP45_YEAST	RRP45	physical	14759368
CSL4_YEAST	CSL4	physical	14759368
RRP4_YEAST	RRP4	physical	14759368
RRP40_YEAST	RRP40	physical	14759368
RRP42_YEAST	RRP42	physical	14759368
RRP43_YEAST	RRP43	physical	14759368
RRP46_YEAST	RRP46	physical	14759368
RRP6_YEAST	RRP6	physical	14759368
RRP41_YEAST	SKI6	physical	14759368
SKI7_YEAST	SKI7	physical	14759368
RRP44_YEAST	DIS3	physical	11805826
RRP45_YEAST	RRP45	physical	11805826
CSL4_YEAST	CSL4	physical	11805826
MTR3_YEAST	MTR3	physical	11805826
RRP4_YEAST	RRP4	physical	11805826
RRP40_YEAST	RRP40	physical	11805826
RRP42_YEAST	RRP42	physical	11805826
RRP43_YEAST	RRP43	physical	11805826
RRP6_YEAST	RRP6	physical	11805826
RRP41_YEAST	SKI6	physical	11805826
SKI7_YEAST	SKI7	physical	11805826
IMA1_YEAST	SRP1	physical	11805826
UTP22_YEAST	UTP22	physical	11805826
LRP1_YEAST	LRP1	physical	11805826
RRP45_YEAST	RRP45	physical	12837249
MTR4_YEAST	MTR4	physical	12837249
RRP44_YEAST	DIS3	physical	12837249
RRP6_YEAST	RRP6	physical	12837249
SKI7_YEAST	SKI7	physical	12837249
RRP43_YEAST	RRP43	physical	12837249
RRP4_YEAST	RRP4	physical	12837249
CSL4_YEAST	CSL4	physical	12837249
PNO1_YEAST	PNO1	physical	12837249
RRP42_YEAST	RRP42	physical	12837249
RRP40_YEAST	RRP40	physical	12837249
RRP41_YEAST	SKI6	physical	12837249
MTR3_YEAST	MTR3	physical	12837249
LRP1_YEAST	LRP1	physical	12837249
RRP43_YEAST	RRP43	physical	16554755
RRP42_YEAST	RRP42	physical	16554755
RRP45_YEAST	RRP45	physical	16554755
RRP41_YEAST	SKI6	physical	16554755
RRP4_YEAST	RRP4	physical	16554755
CSL4_YEAST	CSL4	physical	16554755
MPP6_YEAST	MPP6	physical	16554755
RRP44_YEAST	DIS3	physical	16554755
RRP6_YEAST	RRP6	physical	16554755
SKI7_YEAST	SKI7	physical	16554755
RRP40_YEAST	RRP40	physical	16554755
CSL4_YEAST	CSL4	physical	16429126
RRP44_YEAST	DIS3	physical	16429126
LRP1_YEAST	LRP1	physical	16429126
MTR3_YEAST	MTR3	physical	16429126
RRP4_YEAST	RRP4	physical	16429126
RRP40_YEAST	RRP40	physical	16429126
RRP42_YEAST	RRP42	physical	16429126
RRP43_YEAST	RRP43	physical	16429126
RRP45_YEAST	RRP45	physical	16429126
RRP6_YEAST	RRP6	physical	16429126
RRP41_YEAST	SKI6	physical	16429126
SKI7_YEAST	SKI7	physical	16429126
RRP43_YEAST	RRP43	physical	17391830
RRP44_YEAST	DIS3	physical	17942686
RRP43_YEAST	RRP43	physical	17942686
RRP4_YEAST	RRP4	physical	17942686
CSL4_YEAST	CSL4	physical	17942686
RRP45_YEAST	RRP45	physical	17942686
RRP41_YEAST	SKI6	physical	17942686
MTR3_YEAST	MTR3	physical	17942686
RRP42_YEAST	RRP42	physical	17942686
RRP40_YEAST	RRP40	physical	17942686
HSP71_YEAST	SSA1	physical	19536198
RRP44_YEAST	DIS3	physical	24336220
RRP43_YEAST	RRP43	physical	24336220
RRP4_YEAST	RRP4	physical	24336220
CSL4_YEAST	CSL4	physical	24336220
RRP45_YEAST	RRP45	physical	24336220
RRP46_YEAST	RRP46	physical	24336220
RRP41_YEAST	SKI6	physical	24336220
RRP42_YEAST	RRP42	physical	24336220
MTR3_YEAST	MTR3	physical	24336220
RRP40_YEAST	RRP40	physical	24336220
RRP45_YEAST	RRP45	physical	27174052
RRP41_YEAST	SKI6	physical	27174052
RRP43_YEAST	RRP43	physical	27174052
RRP46_YEAST	RRP46	physical	27174052
RRP42_YEAST	RRP42	physical	27174052
MTR3_YEAST	MTR3	physical	27174052
RRP40_YEAST	RRP40	physical	27174052
RRP4_YEAST	RRP4	physical	27174052
CSL4_YEAST	CSL4	physical	27174052
RRP44_YEAST	DIS3	physical	27174052
SKI7_YEAST	SKI7	physical	27174052
LRP1_YEAST	LRP1	physical	27174052

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.