UniProt ID | UTP11_YEAST | |
---|---|---|
UniProt AC | P34247 | |
Protein Name | U3 small nucleolar RNA-associated protein 11 | |
Gene Name | UTP11 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 250 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Involved in nucleolar processing of pre-18S ribosomal RNA.. | |
Protein Sequence | MAKLVHDVQKKQHRERSQLTSRSRYGFLEKHKDYVKRAQDFHRKQSTLKVLREKAKERNPDEYYHAMHSRKTDAKGLLISSRHGDEEDESLSMDQVKLLKTQDSNYVRTLRQIELKKLEKGAKQLMFKSSGNHTIFVDSREKMNEFTPEKFFNTTSEMVNRSENRLTKDQLAQDISNNRNASSIMPKESLDKKKLKKFKQVKQHLQRETQLKQVQQRMDAQRELLKKGSKKKIVDSSGKISFKWKKQRKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Acetylation | KLVHDVQKKQHRERS HHHHHHHHHHHHHHH | 55.00 | 25381059 | |
49 | Acetylation | HRKQSTLKVLREKAK HHHHHHHHHHHHHHH | 39.03 | 25381059 | |
80 | Phosphorylation | DAKGLLISSRHGDEE CCCCCEEECCCCCCC | 22.68 | 30377154 | |
81 | Phosphorylation | AKGLLISSRHGDEED CCCCEEECCCCCCCC | 22.69 | 27214570 | |
92 | Phosphorylation | DEEDESLSMDQVKLL CCCCCCCCHHHHHHH | 29.59 | 27017623 | |
97 | Acetylation | SLSMDQVKLLKTQDS CCCHHHHHHHHHCCC | 42.33 | 24489116 | |
100 | Acetylation | MDQVKLLKTQDSNYV HHHHHHHHHCCCHHH | 55.35 | 25381059 | |
104 | Phosphorylation | KLLKTQDSNYVRTLR HHHHHCCCHHHHHHH | 21.90 | 30377154 | |
129 | Phosphorylation | AKQLMFKSSGNHTIF CHHEEEECCCCCEEE | 32.01 | 30377154 | |
130 | Phosphorylation | KQLMFKSSGNHTIFV HHEEEECCCCCEEEE | 44.18 | 30377154 | |
147 | Phosphorylation | REKMNEFTPEKFFNT HHHHHCCCHHHHCCC | 25.10 | 27214570 | |
162 | Phosphorylation | TSEMVNRSENRLTKD HHHHHHHCCCCCCHH | 33.74 | 30377154 | |
168 | Acetylation | RSENRLTKDQLAQDI HCCCCCCHHHHHHHH | 48.33 | 24489116 | |
237 | Phosphorylation | KKKIVDSSGKISFKW CCCCCCCCCCCCEEE | 39.37 | 30377154 | |
241 | Phosphorylation | VDSSGKISFKWKKQR CCCCCCCCEEEHHHC | 25.02 | 30377154 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UTP11_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UTP11_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UTP11_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MPP10_YEAST | MPP10 | physical | 12068309 | |
RRP14_YEAST | RRP14 | physical | 17804645 | |
RRP8_YEAST | RRP8 | genetic | 19061648 | |
RL1D1_YEAST | UTP30 | genetic | 19061648 | |
RRP6_YEAST | RRP6 | genetic | 19061648 | |
MRM2_YEAST | MRM2 | genetic | 19061648 | |
SYMM_YEAST | MSM1 | genetic | 19061648 | |
PHO23_YEAST | PHO23 | genetic | 19061648 | |
SYKM_YEAST | MSK1 | genetic | 19061648 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...