YO111_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO111_YEAST
• UniProt AC: Q99210
• Protein Name: Maf-like protein YOR111W
• Gene Name: YOR111W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 232
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MSGNSQLPPDVIGFICSKYDIILASTSPRRYEILHDIMGITDLKTMVSTFEENLDKMNYSTDPIGYVCDTSWHKAQNIIEILTDYEDENPNEIDKPKLIICADTIIIDKSGRIYEKPKTKEVQKKFLMKFCYEDDEPVNVVTAVTLIKWYGRENFELVPFRDETKVYFDNKIPLRILEEYVESGDGLEVGGGFKIQGQGAILIEKIEGDYYNVVGLPLNKTFKGLYAEANSI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YO111_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO111_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO111_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO111_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ENT1_YEAST	ENT1	physical	11283351
YO111_YEAST	YOR111W	physical	11283351
YO111_YEAST	YOR111W	physical	18719252
TPS2_YEAST	TPS2	genetic	27708008
BCS1_YEAST	BCS1	genetic	27708008
ERC1_YEAST	ERC1	genetic	27708008
NDK_YEAST	YNK1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.