dbPTM

YCT3_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YCT3_YEAST
UniProt AC	P25361
Protein Name	Uncharacterized protein YCR043C
Gene Name	YCR043C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	127
Subcellular Localization
Protein Description
Protein Sequence	MIPAPLDASLLREHAFQGTNDLSTVLSPSTFTDEGGYKPVLKYGLGYFNYGLVIDDEVYDYSVCDIIRGHVYDHFWCYFCCFMILFTIWLISLNWCPSSKKSKFDWSKKKDDFKMEGGDLEYQHVKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
114	Ubiquitination	SKKKDDFKMEGGDLE HHCHHCCCCCCCCCE	42.93	23749301
126	Ubiquitination	DLEYQHVKI------ CCEEEEECC------	40.34	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YCT3_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YCT3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YCT3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PMT2_YEAST	PMT2	physical	16554755
H2B2_YEAST	HTB2	physical	16554755
HSP73_YEAST	SSA3	physical	16554755
H4_YEAST	HHF1	physical	16554755
RV161_YEAST	RVS161	physical	16554755
PBP4_YEAST	PBP4	physical	16554755
PMT1_YEAST	PMT1	physical	16554755
HMO1_YEAST	HMO1	physical	16554755
YRA1_YEAST	YRA1	physical	16554755
RV167_YEAST	RVS167	physical	16554755
ANP1_YEAST	ANP1	physical	16554755
CORO_YEAST	CRN1	physical	16554755
NOP53_YEAST	NOP53	physical	16554755
GAS3_YEAST	GAS3	genetic	16269340
SNA3_YEAST	SNA3	physical	18467557
LPP1_YEAST	LPP1	physical	18467557
YMP0_YEAST	YMR010W	physical	18467557
GOT1_YEAST	GOT1	physical	18467557
EPT1_YEAST	EPT1	physical	18467557
SCS7_YEAST	SCS7	physical	18467557
TVP15_YEAST	TVP15	physical	18467557
COS4_YEAST	COS4	physical	18467557
RBD2_YEAST	RBD2	physical	18467557
AKR1_YEAST	AKR1	physical	18467557
SNA3_YEAST	SNA3	physical	22615397
HSP72_YEAST	SSA2	physical	22940862
HSP71_YEAST	SSA1	physical	22940862
KPYK1_YEAST	CDC19	physical	22940862
G3P3_YEAST	TDH3	physical	22940862
SSB1_YEAST	SSB1	physical	22940862

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YCT3_YEAST

Related Literatures of Post-Translational Modification