dbPTM

COS4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COS4_YEAST
UniProt AC	P43542
Protein Name	Protein COS4
Gene Name	COS4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	379
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLSVWWKLSNNWIYPLMVSLLVLFWGPVFVLVIFRLSRKRSLSKQLTQFCKEITKSTPSSDPHDWEVVAANLNSYLYENKAWNIRYFFFNAMGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSVPYIEEALGVYFREVEKQWKLFNSEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLIPFLNFLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQESGANGWDEIARKMNRYLFEKKVWKNEEFFFDGIDCEWFFSHFFYRVLSAKKSMRALSLNVELWPYIKEAQLSCSEESLA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Ubiquitination	-MKENELKNEKSVDV -CCHHHCCCCCCCCE	57.81	24961812
10	Ubiquitination	ENELKNEKSVDVLSF HHHCCCCCCCCEEEH	66.24	23749301
11	Phosphorylation	NELKNEKSVDVLSFK HHCCCCCCCCEEEHH	19.85	22890988
16	Phosphorylation	EKSVDVLSFKQLESQ CCCCCEEEHHHHHHC	30.19	22369663
18	Ubiquitination	SVDVLSFKQLESQKI CCCEEEHHHHHHCCE	51.07	23749301
199	Ubiquitination	REVEKQWKLFNSEKS HHHHHHHHHHCCCCC	40.48	23749301
205	Ubiquitination	WKLFNSEKSWSPVGL HHHHCCCCCCCCCCH	57.98	23749301
216	Ubiquitination	PVGLEDAKLPKEAYR CCCHHCCCCCHHHHH	77.10	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COS4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COS4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COS4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TMEDA_YEAST	ERV25	physical	18467557
CP51_YEAST	ERG11	physical	18467557
MKAR_YEAST	IFA38	physical	16093310
ELO2_YEAST	ELO2	physical	16093310
ATG15_YEAST	ATG15	physical	16093310
ERS1_YEAST	ERS1	physical	16093310
PMT7_YEAST	PMT7	physical	16093310
SHO1_YEAST	SHO1	physical	16093310
HIP1_YEAST	HIP1	physical	16093310
SNL1_YEAST	SNL1	physical	16093310
BTN1_YEAST	YHC3	physical	16093310
PRM10_YEAST	PRM10	physical	16093310
AUR1_YEAST	AUR1	physical	16093310
SMF3_YEAST	SMF3	physical	16093310
THI7_YEAST	THI7	physical	16093310
ELO3_YEAST	ELO3	physical	16093310
GSF2_YEAST	GSF2	physical	16093310
FMP42_YEAST	YMR221C	physical	16093310
FKS3_YEAST	FKS3	physical	16093310
NRT1_YEAST	NRT1	physical	16093310
ATX2_YEAST	ATX2	physical	16093310
ECM3_YEAST	ECM3	physical	16093310
AQY1_YEAST	AQY1	physical	16093310
RSP5_YEAST	RSP5	physical	25942624

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COS4_YEAST

Related Literatures of Post-Translational Modification

Ubiquitylation
Reference	PubMed
"A subset of membrane-associated proteins is ubiquitinated in responseto mutations in the endoplasmic reticulum degradation machinery."; Hitchcock A.L., Auld K., Gygi S.P., Silver P.A.; Proc. Natl. Acad. Sci. U.S.A. 100:12735-12740(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-205, AND MASSSPECTROMETRY.	14557538 [Abstract]
"A proteomics approach to understanding protein ubiquitination."; Peng J., Schwartz D., Elias J.E., Thoreen C.C., Cheng D.,Marsischky G., Roelofs J., Finley D., Gygi S.P.; Nat. Biotechnol. 21:921-926(2003). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-205, AND MASSSPECTROMETRY.	12872131 [Abstract]