UniProt ID | CBP6_YEAST | |
---|---|---|
UniProt AC | P07253 | |
Protein Name | Cytochrome B pre-mRNA-processing protein 6 | |
Gene Name | CBP6 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 162 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | This protein is involved in processing of the 5' terminus and the intervening sequences of cytochrome b pre-mRNA.. | |
Protein Sequence | MSSSQVVRDSAKKLVNLLEKYPKDRIHHLVSFRDVQIARFRRVAGLPNVDDKGKSIKEKKPSLDEIKSIINRTSGPLGLNKEMLTKIQNKMVDEKFTEESINEQIRALSTIMNNKFRNYYDIGDKLYKPAGNPQYYQRLINAVDGKKKESLFTAMRTVLFGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSSSQVVRD ------CCHHHHHHH | 38.40 | 22814378 | |
13 | Acetylation | VVRDSAKKLVNLLEK HHHHHHHHHHHHHHH | 58.34 | 22865919 | |
20 | Acetylation | KLVNLLEKYPKDRIH HHHHHHHHCCCCHHH | 67.81 | 24489116 | |
52 | Acetylation | GLPNVDDKGKSIKEK CCCCCCCCCCCHHHC | 64.87 | 24489116 | |
62 | Phosphorylation | SIKEKKPSLDEIKSI CHHHCCCCHHHHHHH | 58.28 | 21440633 | |
73 | Phosphorylation | IKSIINRTSGPLGLN HHHHHHHCCCCCCCC | 33.28 | 28889911 | |
74 | Phosphorylation | KSIINRTSGPLGLNK HHHHHHCCCCCCCCH | 34.87 | 20377248 | |
95 | Acetylation | QNKMVDEKFTEESIN HHHHCCCCCCHHHHH | 53.79 | 24489116 | |
97 | Phosphorylation | KMVDEKFTEESINEQ HHCCCCCCHHHHHHH | 50.33 | 28889911 | |
115 | Acetylation | LSTIMNNKFRNYYDI HHHHHHHCCCCCEEC | 40.47 | 24489116 | |
150 | Phosphorylation | VDGKKKESLFTAMRT HCCCCHHHHHHHHHH | 37.35 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBP6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBP6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBP6_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Profiling phosphoproteins of yeast mitochondria reveals a role ofphosphorylation in assembly of the ATP synthase."; Reinders J., Wagner K., Zahedi R.P., Stojanovski D., Eyrich B.,van der Laan M., Rehling P., Sickmann A., Pfanner N., Meisinger C.; Mol. Cell. Proteomics 6:1896-1906(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-97, AND MASSSPECTROMETRY. |