UniProt ID | SHY1_YEAST | |
---|---|---|
UniProt AC | P53266 | |
Protein Name | Cytochrome oxidase assembly protein SHY1 | |
Gene Name | SHY1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 389 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Required for efficient assembly of cytochrome c oxidase in the mitochondrial inner membrane. Involved in a step that couples MSS51-COX14-dependent regulation of COX1 translation to early steps of cytochrome c oxidase assembly.. | |
Protein Sequence | MSLLGARSTYRWFSIAASIPTKNAIGKSTYLLASRNQQYRGIITSTVDWKPIKTGKSPNDDSRRERSFGKKIVLGLMFAMPIISFYLGTWQVRRLKWKTKLIAACETKLTYEPIPLPKSFTPDMCEDWEYRKVILTGHFLHNEEMFVGPRKKNGEKGYFLFTPFIRDDTGEKVLIERGWISEEKVAPDSRNLHHLSLPQEEHLKVVCLVRPPKKRGSLQWAKKDPNSRLWQVPDIYDMARSSGCTPIQFQALYDMKDHPIIEEHTRNEASQNNSTSSLWKFWKREPTTAVNGTQAVDNNTSKPRSRQEMPTDQTIEFDERQFIKAGVPIGRKPTIDLKNNHLQYLVTWYGLSFLSTIFLIVALRKAKRGGVVSQDQLMKEKLKHSRKYM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MSLLGARSTYRWFSI CCCCCCCCCCHHHHH | 29.29 | 27017623 | |
9 | Phosphorylation | SLLGARSTYRWFSIA CCCCCCCCCHHHHHE | 16.14 | 27017623 | |
21 | Phosphorylation | SIAASIPTKNAIGKS HHEEECCCCCCCCCH | 34.95 | 27017623 | |
300 | Phosphorylation | TQAVDNNTSKPRSRQ CCCCCCCCCCCCCCC | 44.36 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SHY1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SHY1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SHY1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...