MBI4_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MBI4_YEAST
• UniProt AC: P03879
• Protein Name: Intron-encoded RNA maturase bI4
• Gene Name: BI4
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 638
• Subcellular Localization: Mitochondrion.
• Protein Description: Mitochondrial mRNA maturase required for splicing of intron 4 of the cytochrome b (COB) gene, containing its own coding sequence, and intron 4 in COX1, coding for the related homing endonuclease aI4. In vivo splicing requires in addition the imported mitochondrial leucyl-tRNA synthetase NAM2. Both proteins seem to stimulate the intrinsic ribozyme activity of intron bI4 through binding to and stabilizing specific secondary and tertiary structure elements in the RNA..
• Protein Sequence: MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGQNMALLLITYVINILCAVCWKSLFIKYQWKIYNKTTYYFIIQNILNTKQLNNFVLKFNWTKQYNKMNIVSDLFNPNRVKYYYKEDNQQVTNMNSSNTHLTSNKKNLLVDTSETTRTTKNKFNYLLNIFNMKKMNQIITKRHYSIYKDSNIRFNQWLAGLIDGDGYFCITKNKYASCEITVELKDEKMLRQIQDKFGGSVKLRSGVKAIRYRLQNKEGMIKLINAVNGNIRNSKRLVQFNKVCILLNIDFKEPIKLTKDNAWFMGFFDADGTINYYYSGKLKIRPQLTISVTNKYLHDVEYYREVFGGNIYFDKAKNGYFKWSINNKELHNIFYTYNKSCPSKSNKGKRLFLIDKFYYLYDLLAFKAPHNTALYKAWLKFNEKWNNN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
332	Phosphorylation	FNPNRVKYYYKEDNQ CCCCCEEEEEECCCC	14.79	28132839
333	Phosphorylation	NPNRVKYYYKEDNQQ CCCCEEEEEECCCCE	11.44	28132839
334	Phosphorylation	PNRVKYYYKEDNQQV CCCEEEEEECCCCEE	12.57	28132839

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MBI4_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MBI4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MBI4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MTF2_YEAST	MTF2	genetic	8917309
SYLM_YEAST	NAM2	genetic	6207024
MBI4_YEAST	BI4	physical	19622748
SYLM_YEAST	NAM2	physical	11142386
SYLM_YEAST	NAM2	physical	12486008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.