| UniProt ID | CYB_YEAST | |
|---|---|---|
| UniProt AC | P00163 | |
| Protein Name | Cytochrome b | |
| Gene Name | COB | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 385 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.. | |
| Protein Sequence | MAFRKSNVYLSLVNSYIIDSPQPSSINYWWNMGSLLGLCLVIQIVTGIFMAMHYSSNIELAFSSVEHIMRDVHNGYILRYLHANGASFFFMVMFMHMAKGLYYGSYRSPRVTLWNVGVIIFILTIATAFLGYCCVYGQMSHWGATVITNLFSAIPFVGNDIVSWLWGGFSVSNPTIQRFFALHYLVPFIIAAMVIMHLMALHIHGSSNPLGITGNLDRIPMHSYFIFKDLVTVFLFMLILALFVFYSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAILRSIPDKLLGVITMFAAILVLLVLPFTDRSVVRGNTFKVLSKFFFFIFVFNFVLLGQIGACHVEVPYVLMGQIATFIYFAYFLIIVPVISTIENVLFYIGRVNK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CYB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYB_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYB_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYB_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MTF2_YEAST | MTF2 | genetic | 2651895 | |
| NAM7_YEAST | NAM7 | genetic | 2651895 | |
| NAM8_YEAST | NAM8 | genetic | 2651895 | |
| PT127_YEAST | PET127 | genetic | 10101159 | |
| MRS2_YEAST | MRS2 | genetic | 21278281 | |
| MRS3_YEAST | MRS3 | genetic | 21278281 | |
| CBP1_YEAST | CBP1 | genetic | 10101159 | |
| COX2_YEAST | COX2 | physical | 23007649 | |
| CBP3_YEAST | CBP3 | physical | 23007649 | |
| CBP6_YEAST | CBP6 | physical | 23007649 | |
| CBP4_YEAST | CBP4 | physical | 23007649 | |
| QCR7_YEAST | QCR7 | physical | 23007649 | |
| QCR8_YEAST | QCR8 | physical | 23007649 | |
| QCR7_YEAST | QCR7 | physical | 24841564 | |
| QCR1_YEAST | COR1 | physical | 24841564 | |
| RCF1_YEAST | RCF1 | physical | 24841564 | |
| UCRI_YEAST | RIP1 | physical | 24841564 | |
| QCR8_YEAST | QCR8 | physical | 24841564 | |
| CY1_YEAST | CYT1 | physical | 24841564 | |
| CBP3_YEAST | CBP3 | physical | 24841564 | |
| CBP4_YEAST | CBP4 | physical | 24841564 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
