| UniProt ID | COA1_YEAST | |
|---|---|---|
| UniProt AC | P40452 | |
| Protein Name | Cytochrome c oxidase assembly factor 1 | |
| Gene Name | COA1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 197 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . |
|
| Protein Description | Required for efficient assembly of cytochrome c oxidase in the mitochondrial inner membrane. Involved in a step coupling MSS51-dependent cotranslational insertion of COX1 to the addition of its heme A and copper B cofactors.. | |
| Protein Sequence | MMLRLVTKGLPKVTPSAAKAVLVRGSLLHSFSTSARFNNSVAEDEAKIVLKDKNRPLRIDRELPDPTTERRKRIAGFLLFSVAIGSALSLIFNYEKTESPIISNTLYYIRRSPATKNILGESIEFDGIIPWVYGELNSVKGRINITFYIKGDKNVTGTVRLVADRNTHDEEFLIHEWSVTAAGQKIDLLAENTKTPI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 156 | Phosphorylation | IKGDKNVTGTVRLVA EECCCCEEEEEEEEE | 36.21 | 19684113 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of COA1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of COA1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of COA1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
