dbPTM

COA2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COA2_YEAST
UniProt AC	Q3E823
Protein Name	Cytochrome c oxidase assembly factor 2
Gene Name	COA2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	68
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side . Mitochondrial matrix soluble protein partially associated with the inner membrane.
Protein Description	Required for efficient assembly of cytochrome c oxidase in the mitochondrial inner membrane. Seems to be involved in the SHY1-mediated step of cytochrome c oxidase maturation. May aid in stabilizing an early COX1 intermediate containing the nuclear subunits COX5A and COX6..
Protein Sequence	MRAVTRNKIVNNLYFSTFLIAFASVAIGSVLPCPAHSVDSDSPAVQQHKLQLAHEQELKRKDALSKKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of COA2_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COA2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COA2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COA2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MSS51_YEAST	MSS51	genetic	18541668
COX14_YEAST	COX14	genetic	18541668
COA1_YEAST	COA1	genetic	18541668
SHY1_YEAST	SHY1	physical	18541668
COX6_YEAST	COX6	genetic	18541668
COX10_YEAST	COX10	genetic	19841065
OMA1_YEAST	OMA1	genetic	19841065
YME1_YEAST	YME1	genetic	19841065
YTA12_YEAST	YTA12	genetic	19841065
COX15_YEAST	COX15	genetic	19841065
YTA12_YEAST	YTA12	genetic	18541668
SHY1_YEAST	SHY1	genetic	18541668
COX1_YEAST	COX1	genetic	18541668
COX10_YEAST	COX10	genetic	18541668
COX5A_YEAST	COX5A	genetic	18541668
AFG3_YEAST	AFG3	genetic	22219186
OMA1_YEAST	OMA1	genetic	24648523
BRE5_YEAST	BRE5	genetic	27708008
IPYR_YEAST	IPP1	genetic	27708008
CDK1_YEAST	CDC28	genetic	27708008
POP7_YEAST	POP7	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
PDC2_YEAST	PDC2	genetic	27708008
CDC1_YEAST	CDC1	genetic	27708008
PSB3_YEAST	PUP3	genetic	27708008
RSP5_YEAST	RSP5	genetic	27708008
YPT1_YEAST	YPT1	genetic	27708008
PRS7_YEAST	RPT1	genetic	27708008
RPC6_YEAST	RPC34	genetic	27708008
PRS10_YEAST	RPT4	genetic	27708008
DEP1_YEAST	DEP1	genetic	27708008
PMP3_YEAST	PMP3	genetic	27708008
PTK2_YEAST	PTK2	genetic	27708008
RGT1_YEAST	RGT1	genetic	27708008
BRE2_YEAST	BRE2	genetic	27708008
SRN2_YEAST	SRN2	genetic	27708008
GAL80_YEAST	GAL80	genetic	27708008
PFKA2_YEAST	PFK2	genetic	27708008
SAP30_YEAST	SAP30	genetic	27708008
LEO1_YEAST	LEO1	genetic	27708008
PDE2_YEAST	PDE2	genetic	27708008
VPS4_YEAST	VPS4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COA2_YEAST

Related Literatures of Post-Translational Modification