| UniProt ID | POP6_YEAST | |
|---|---|---|
| UniProt AC | P53218 | |
| Protein Name | Ribonucleases P/MRP protein subunit POP6 | |
| Gene Name | POP6 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 158 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences.. | |
| Protein Sequence | MINGVYYNEISRDLDISSSTQCLRFLKETVIPSLANNGNNSTSIQYHGISKNDNIKKSVNKLDKQINMADRSLGLQQVVCIFSYGPHIQKMLSILEIFKKGYIKNNKKIYQWNKLTSFDIKREGRNELQEERLKVPILVTLVSDSEIIDLNLHSFTKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of POP6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP6_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP6_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP6_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| POP1_YEAST | POP1 | physical | 11880623 | |
| POP4_YEAST | POP4 | physical | 11880623 | |
| POP5_YEAST | POP5 | physical | 11880623 | |
| POP7_YEAST | POP7 | physical | 11880623 | |
| RMRP_YEAST | SNM1 | physical | 11880623 | |
| RPP1_YEAST | RPP1 | physical | 16554755 | |
| POP7_YEAST | POP7 | physical | 17717080 | |
| POP1_YEAST | POP1 | physical | 17881380 | |
| POP5_YEAST | POP5 | physical | 17881380 | |
| RMP1_YEAST | RMP1 | physical | 17881380 | |
| RPP1_YEAST | RPP1 | physical | 17881380 | |
| POP7_YEAST | POP7 | physical | 20057077 | |
| EST1_YEAST | EST1 | physical | 27156450 | |
| TERT_YEAST | EST2 | physical | 27156450 | |
| POP7_YEAST | POP7 | genetic | 27708008 | |
| TFC8_YEAST | TFC8 | genetic | 27708008 | |
| PEX32_YEAST | PEX32 | genetic | 27708008 | |
| REXO1_YEAST | RNH70 | genetic | 27708008 | |
| GIC1_YEAST | GIC1 | genetic | 27708008 | |
| ENV10_YEAST | ENV10 | genetic | 27708008 | |
| BRR1_YEAST | BRR1 | genetic | 27708008 | |
| SHLB1_HUMAN | SH3GLB1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
