| UniProt ID | POP5_YEAST | |
|---|---|---|
| UniProt AC | P28005 | |
| Protein Name | Ribonuclease P/MRP protein subunit POP5 | |
| Gene Name | POP5 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 173 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences.. | |
| Protein Sequence | MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Ubiquitination | NVEESVSKADILLSH CHHHHHCHHHHHHHC | 48.17 | 17644757 | |
| 46 | Acetylation | SPADVSIKSILQEIR CHHHCCHHHHHHHHH | 24.76 | 24489116 | |
| 118 | Ubiquitination | GLIVNPVKVSGTIKK CEEECCEEECCHHHH | 31.75 | 23749301 | |
| 124 | Acetylation | VKVSGTIKKIEQFAM EEECCHHHHHHHHHH | 47.76 | 25381059 | |
| 125 | Ubiquitination | KVSGTIKKIEQFAMR EECCHHHHHHHHHHH | 47.85 | 23749301 | |
| 150 | Phosphorylation | CSQSSHLSDNDFIIN ECCCCCCCCCCCCCC | 29.01 | 30377154 | |
| 161 | Ubiquitination | FIINDFKKIGRENEN CCCCCHHHHCCCCCC | 50.84 | 23749301 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP5_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP5_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP5_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
