UniProt ID | POP5_YEAST | |
---|---|---|
UniProt AC | P28005 | |
Protein Name | Ribonuclease P/MRP protein subunit POP5 | |
Gene Name | POP5 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 173 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences.. | |
Protein Sequence | MVRLKSRYILFEIIFPPTDTNVEESVSKADILLSHHRASPADVSIKSILQEIRRSLSLNLGDYGSAKCNSLLQLKYFSNKTSTGIIRCHREDCDLVIMALMLMSKIGDVDGLIVNPVKVSGTIKKIEQFAMRRNSKILNIIKCSQSSHLSDNDFIINDFKKIGRENENENEDD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Ubiquitination | NVEESVSKADILLSH CHHHHHCHHHHHHHC | 48.17 | 17644757 | |
46 | Acetylation | SPADVSIKSILQEIR CHHHCCHHHHHHHHH | 24.76 | 24489116 | |
118 | Ubiquitination | GLIVNPVKVSGTIKK CEEECCEEECCHHHH | 31.75 | 23749301 | |
124 | Acetylation | VKVSGTIKKIEQFAM EEECCHHHHHHHHHH | 47.76 | 25381059 | |
125 | Ubiquitination | KVSGTIKKIEQFAMR EECCHHHHHHHHHHH | 47.85 | 23749301 | |
150 | Phosphorylation | CSQSSHLSDNDFIIN ECCCCCCCCCCCCCC | 29.01 | 30377154 | |
161 | Ubiquitination | FIINDFKKIGRENEN CCCCCHHHHCCCCCC | 50.84 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP5_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...