| UniProt ID | POP4_YEAST | |
|---|---|---|
| UniProt AC | P38336 | |
| Protein Name | RNases MRP/P 32.9 kDa subunit | |
| Gene Name | POP4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 279 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for 5.8S rRNA and tRNA processing; associated with RNase MRP and RNase P.. | |
| Protein Sequence | MDRTQTFIKDCLFTKCLEDPEKPFNENRFQDTLLLLPTDGGLTSRLQRQQRKSKLNLDNLQKVSQLESADKQLEKRDYQRINKNSKIALREYINNCKKNTKKCLKLAYENKITDKEDLLHYIEEKHPTIYESLPQYVDFVPMYKELWINYIKELLNITKNLKTFNGSLALLKLSMADYNGALLRVTKSKNKTLIGLQGIVIWDSQKFFIMIVKGNIIDEIKCIPKKGTVFQFEIPISDDDDSALRYSILGDRFKYRSVDRAGRKFKSRRCDDMLYYIQN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Ubiquitination | DRTQTFIKDCLFTKC CHHHHHHHHHHHHHH | 37.89 | 17644757 | |
| 15 | Ubiquitination | IKDCLFTKCLEDPEK HHHHHHHHHCCCCCC | 29.50 | 17644757 | |
| 22 | Ubiquitination | KCLEDPEKPFNENRF HHCCCCCCCCCCCCC | 61.37 | 17644757 | |
| 53 | Phosphorylation | LQRQQRKSKLNLDNL HHHHHHHHCCCHHHH | 44.56 | 25752575 | |
| 64 | Phosphorylation | LDNLQKVSQLESADK HHHHHHHHHHHHHHH | 35.76 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND MASSSPECTROMETRY. | |
