| UniProt ID | POP3_YEAST | |
|---|---|---|
| UniProt AC | P53833 | |
| Protein Name | Ribonucleases P/MRP protein subunit POP3 | |
| Gene Name | POP3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 195 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for processing of 5.8S rRNA (short form) at site A3 and for 5'- and 3'-processing of pre-tRNA.. | |
| Protein Sequence | MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVKLLKTTVPIVSKKRQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSGSLKSLD ------CCCCHHHHH | 36.77 | 19823750 | |
| 4 | Phosphorylation | ----MSGSLKSLDKK ----CCCCHHHHHHH | 25.89 | 19823750 | |
| 7 | Phosphorylation | -MSGSLKSLDKKIAK -CCCCHHHHHHHHHH | 47.28 | 19823750 | |
| 138 | Phosphorylation | TFKSVSKYGMLLLRC HHHHHHHHCCEEEEE | 10.56 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of POP3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of POP3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of POP3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
