UniProt ID | SC6B1_YEAST | |
---|---|---|
UniProt AC | P52870 | |
Protein Name | Protein transport protein SBH1 | |
Gene Name | SBH1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 82 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. |
|
Protein Description | Part of the Sec61 complex, which is the major component of a channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). The functional states of the translocon complex include co- and post-translational ER import, cotranslational membrane protein integration and retrograde transport of misfolded proteins out of the ER. In the cotranslational pathway, ribosomes synthesizing presecretory proteins are targeted to the translocon by the cytosolic signal recognition particle (SRP) and its ER-localized receptor. The association of the Sec61 complex with the ribosome is mediated by the 28S rRNA of the large ribosomal subunit. SRP-independent post-translational translocation requires the association of additional factors, such as the Sec62/63 complex and KAR2.. | |
Protein Sequence | MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSPTPPGG ------CCCCCCCCC | 45.05 | 24909858 | |
3 | Phosphorylation | -----MSSPTPPGGQ -----CCCCCCCCCH | 31.34 | 24909858 | |
5 | Phosphorylation | ---MSSPTPPGGQRT ---CCCCCCCCCHHC | 44.02 | 24909858 | |
12 | Phosphorylation | TPPGGQRTLQKRKQG CCCCCHHCHHHHCCC | 26.17 | 19823750 | |
21 | Phosphorylation | QKRKQGSSQKVAASA HHHCCCCCHHHHHCC | 40.62 | 23749301 | |
23 | Ubiquitination | RKQGSSQKVAASAPK HCCCCCHHHHHCCCC | 35.47 | 23749301 | |
27 | Phosphorylation | SSQKVAASAPKKNTN CCHHHHHCCCCCCCC | 35.05 | 29136822 | |
31 | Ubiquitination | VAASAPKKNTNSNNS HHHCCCCCCCCCCCC | 68.87 | 23749301 | |
33 | Phosphorylation | ASAPKKNTNSNNSIL HCCCCCCCCCCCCCE | 49.23 | 19823750 | |
35 | Phosphorylation | APKKNTNSNNSILKI CCCCCCCCCCCCEEE | 35.04 | 27214570 | |
38 | Phosphorylation | KNTNSNNSILKIYSD CCCCCCCCCEEECCC | 33.28 | 19795423 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC6B1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC6B1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC6B1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...