| UniProt ID | SC6B2_YEAST | |
|---|---|---|
| UniProt AC | P52871 | |
| Protein Name | Protein transport protein SBH2 | |
| Gene Name | SBH2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 88 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein. |
|
| Protein Description | Part of the Ssh1 complex, which probably is the major component of a channel-forming translocon complex that may function exclusively in the cotranslational pathway of protein endoplasmic reticulum (ER) import.. | |
| Protein Sequence | MAASVPPGGQRILQKRRQAQSIKEKQAKQTPTSTRQAGYGGSSSSILKLYTDEANGFRVDSLVVLFLSVGFIFSVIALHLLTKFTHII | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Phosphorylation | QKRRQAQSIKEKQAK HHHHHHHHHHHHHHH | 38.35 | 30377154 | |
| 30 | Phosphorylation | KEKQAKQTPTSTRQA HHHHHHCCCCCCCCC | 28.03 | 19823750 | |
| 32 | Phosphorylation | KQAKQTPTSTRQAGY HHHHCCCCCCCCCCC | 46.23 | 19823750 | |
| 33 | Phosphorylation | QAKQTPTSTRQAGYG HHHCCCCCCCCCCCC | 23.85 | 19823750 | |
| 34 | Phosphorylation | AKQTPTSTRQAGYGG HHCCCCCCCCCCCCC | 29.31 | 19823750 | |
| 39 | Phosphorylation | TSTRQAGYGGSSSSI CCCCCCCCCCCHHHH | 22.71 | 19823750 | |
| 42 | Phosphorylation | RQAGYGGSSSSILKL CCCCCCCCHHHHHHH | 23.76 | 19823750 | |
| 43 | Phosphorylation | QAGYGGSSSSILKLY CCCCCCCHHHHHHHH | 31.23 | 27214570 | |
| 44 | Phosphorylation | AGYGGSSSSILKLYT CCCCCCHHHHHHHHC | 24.08 | 19823750 | |
| 45 | Phosphorylation | GYGGSSSSILKLYTD CCCCCHHHHHHHHCC | 33.61 | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SC6B2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SC6B2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SC6B2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
