| UniProt ID | RPR2_YEAST | |
|---|---|---|
| UniProt AC | P40571 | |
| Protein Name | Ribonuclease P protein subunit RPR2 | |
| Gene Name | RPR2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 144 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.. | |
| Protein Sequence | MGKKAHGGKMKPEIDENGTLLVPPPRTIANQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKRTICKKCHRLLWTPKKLEITSDGALSVMCGCGTVKRFNIGADPNYRTYSEREGNLLNS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 39 | Phosphorylation | DHFHRLNYLYQISAY CCHHHHHHHHHHHHH | 16.04 | 28132839 | |
| 41 | Phosphorylation | FHRLNYLYQISAYQT HHHHHHHHHHHHHHH | 8.08 | 28132839 | |
| 46 | Phosphorylation | YLYQISAYQTRARQK HHHHHHHHHHHHHHH | 12.02 | 28132839 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPR2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPR2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPR2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| POP4_YEAST | POP4 | physical | 11880623 | |
| POP6_YEAST | POP6 | physical | 11880623 | |
| RPR2_YEAST | RPR2 | physical | 11880623 | |
| POP5_YEAST | POP5 | physical | 16554755 | |
| POP4_YEAST | POP4 | physical | 16554755 | |
| POP1_YEAST | POP1 | physical | 16554755 | |
| YL345_YEAST | YLR345W | physical | 18719252 | |
| POP1_YEAST | POP1 | physical | 19095620 | |
| POP3_YEAST | POP3 | physical | 19095620 | |
| POP4_YEAST | POP4 | physical | 19095620 | |
| POP5_YEAST | POP5 | physical | 19095620 | |
| POP6_YEAST | POP6 | physical | 19095620 | |
| POP7_YEAST | POP7 | physical | 19095620 | |
| POP8_YEAST | POP8 | physical | 19095620 | |
| RPP1_YEAST | RPP1 | physical | 19095620 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
