| UniProt ID | PEX34_YEAST | |
|---|---|---|
| UniProt AC | P25584 | |
| Protein Name | Peroxisomal membrane protein PEX34 | |
| Gene Name | PEX34 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 144 | |
| Subcellular Localization |
Peroxisome membrane Multi-pass membrane protein . |
|
| Protein Description | In concert with the three peroxisome divisional factors, PEX11, PEX25 and PEX27, controls peroxisome morphology and abundance under conditions of peroxisome proliferation. Maintains mature peroxisomes in actively dividing cells.. | |
| Protein Sequence | MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCISVIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLMVLIYPGTRLFKRLSNIITLCRIIV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PEX34_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX34_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX34_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX34_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PGA3_YEAST | PGA3 | genetic | 16269340 | |
| PMT4_YEAST | PMT4 | genetic | 16269340 | |
| MSH3_YEAST | MSH3 | physical | 18467557 | |
| GGC1_YEAST | GGC1 | physical | 18467557 | |
| ASF2_YEAST | ASF2 | physical | 18467557 | |
| HIS9_YEAST | HIS2 | physical | 18467557 | |
| PEX34_YEAST | PEX34 | physical | 21441307 | |
| PEX11_YEAST | PEX11 | physical | 21441307 | |
| PEX25_YEAST | PEX25 | physical | 21441307 | |
| PEX27_YEAST | PEX27 | physical | 21441307 | |
| FIS1_YEAST | FIS1 | physical | 21441307 | |
| PEX11_YEAST | PEX11 | genetic | 21441307 | |
| PEX27_YEAST | PEX27 | genetic | 21441307 | |
| PEX25_YEAST | PEX25 | genetic | 21441307 | |
| MED14_YEAST | RGR1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
