| UniProt ID | GGC1_YEAST | |
|---|---|---|
| UniProt AC | P38988 | |
| Protein Name | Mitochondrial GTP/GDP carrier protein 1 | |
| Gene Name | GGC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 300 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | Mitochondrial GTP/GDP transporter required for GTP uptake and GDP exit from mitochondria. Involved in mitochondrial iron transport and essential for mitochondrial genome maintenance.. | |
| Protein Sequence | MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHFSEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAMRSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQNRNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | MSNHTKITSGQELNR HCCCCCCCCCCHHHH | 28.49 | 25521595 | |
| 61 | Phosphorylation | VIFRDHFSEPLGKRL HHHHHCCCCCHHHHH | 34.58 | 25521595 | |
| 82 | Ubiquitination | LGYAASYKVLQRVYK CCHHHHHHHHHHHHH | 33.69 | 17644757 | |
| 82 | Acetylation | LGYAASYKVLQRVYK CCHHHHHHHHHHHHH | 33.69 | 24489116 | |
| 89 | Ubiquitination | KVLQRVYKYGGQPFA HHHHHHHHHCCCCCH | 34.26 | 17644757 | |
| 89 | Acetylation | KVLQRVYKYGGQPFA HHHHHHHHHCCCCCH | 34.26 | 24489116 | |
| 102 | Ubiquitination | FANEFLNKHYKKDFD CHHHHHHHHHHHHHH | 50.92 | 17644757 | |
| 102 | Acetylation | FANEFLNKHYKKDFD CHHHHHHHHHHHHHH | 50.92 | 24489116 | |
| 106 | Acetylation | FLNKHYKKDFDNLFG HHHHHHHHHHHHHCC | 57.36 | 24489116 | |
| 115 | Acetylation | FDNLFGEKTGKAMRS HHHHCCHHHHHHHHH | 64.06 | 24489116 | |
| 160 | Ubiquitination | FKGRGFIKILRDEGL HCCCCCEEEHHCCCC | 33.17 | 17644757 | |
| 267 | Acetylation | EGVTAFFKGLTPKLL CCCHHHHCCCCHHHH | 46.70 | 24489116 | |
| 272 | Acetylation | FFKGLTPKLLTTGPK HHCCCCHHHHCCCCH | 51.39 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GGC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GGC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GGC1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| UBC13_YEAST | UBC13 | physical | 18467557 | |
| CMC1_YEAST | SAL1 | genetic | 18431598 | |
| MPCP_YEAST | MIR1 | genetic | 21189251 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...