| UniProt ID | HCH1_YEAST | |
|---|---|---|
| UniProt AC | P53834 | |
| Protein Name | Hsp90 co-chaperone HCH1 | |
| Gene Name | HCH1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Co-chaperone that binds to the molecular chaperone HSP82 and stimulates its ATPase activity. Although not essential, it confers thermotolerance when intracellular levels of HSP82 are limiting.. | |
| Protein Sequence | MVVLNPNNWHWVDKNTLPWSKDYLNGKLTSLSTVSSDGKSKIELTQVSSITGDSNVSQRKGKPICYFDLQLSMNVKVTNLDTNKDDEDDDGILADGKLEIPEFMHDESDIPILSQGFDAFDGLVRSEFVPKVVETLLKYQDDLIKEHSKDIQV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 21 | Acetylation | KNTLPWSKDYLNGKL CCCCCCCHHHHCCEE | 46.66 | 22865919 | |
| 27 | Acetylation | SKDYLNGKLTSLSTV CHHHHCCEEEEEEEE | 47.74 | 24489116 | |
| 131 | Acetylation | VRSEFVPKVVETLLK HHCHHHHHHHHHHHH | 54.32 | 24489116 | |
| 138 | Acetylation | KVVETLLKYQDDLIK HHHHHHHHHHHHHHH | 43.93 | 24489116 | |
| 145 | Acetylation | KYQDDLIKEHSKDIQ HHHHHHHHHHHCCCC | 57.58 | 24489116 | |
| 145 | Ubiquitination | KYQDDLIKEHSKDIQ HHHHHHHHHHHCCCC | 57.58 | 23749301 | |
| 149 | Acetylation | DLIKEHSKDIQV--- HHHHHHHCCCCC--- | 61.84 | 24489116 | |
| 149 | Ubiquitination | DLIKEHSKDIQV--- HHHHHHHCCCCC--- | 61.84 | 22817900 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HCH1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HCH1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HCH1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
