| UniProt ID | YL297_YEAST | |
|---|---|---|
| UniProt AC | Q05899 | |
| Protein Name | Uncharacterized vacuolar protein YLR297W | |
| Gene Name | YLR297W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 129 | |
| Subcellular Localization |
Vacuole membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MVEGDFVDEQSNIALLSSKSMCGDHHSVKNSIGDEIFKLLTKILNSDEKASGDVHTLVSGTPDLSNFNLDNEPLENILAVFIISFIIVVVGVLLLGLIGMIFISLRSGSSNDKKLQSNDEEKQALAEKA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL297_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL297_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL297_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GET3_YEAST | GET3 | physical | 18719252 | |
| VAM7_YEAST | VAM7 | genetic | 27708008 | |
| RV161_YEAST | RVS161 | genetic | 27708008 | |
| SNX41_YEAST | SNX41 | genetic | 27708008 | |
| RL29_YEAST | RPL29 | genetic | 27708008 | |
| YBP2_YEAST | YBP2 | genetic | 27708008 | |
| RSSA1_YEAST | RPS0A | genetic | 27708008 | |
| YG51_YEAST | YGR237C | genetic | 27708008 | |
| DOT5_YEAST | DOT5 | genetic | 27708008 | |
| MEH1_YEAST | MEH1 | genetic | 27708008 | |
| BRE2_YEAST | BRE2 | genetic | 27708008 | |
| SIC1_YEAST | SIC1 | genetic | 27708008 | |
| STM1_YEAST | STM1 | genetic | 27708008 | |
| RS3A2_YEAST | RPS1B | genetic | 27708008 | |
| VPS9_YEAST | VPS9 | genetic | 27708008 | |
| GTR1_YEAST | GTR1 | genetic | 27708008 | |
| RCO1_YEAST | RCO1 | genetic | 27708008 | |
| RAD14_YEAST | RAD14 | genetic | 27708008 | |
| PFKA2_YEAST | PFK2 | genetic | 27708008 | |
| COX5A_YEAST | COX5A | genetic | 27708008 | |
| MAS5_YEAST | YDJ1 | genetic | 27708008 | |
| YO012_YEAST | YOR012W | genetic | 27708008 | |
| CSK2C_YEAST | CKB2 | genetic | 27708008 | |
| PALA_YEAST | RIM20 | genetic | 27708008 | |
| HSP82_YEAST | HSP82 | genetic | 27708008 | |
| TTC1_HUMAN | TTC1 | physical | 27107014 | |
| SGTA_HUMAN | SGTA | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...