UniProt ID | YL297_YEAST | |
---|---|---|
UniProt AC | Q05899 | |
Protein Name | Uncharacterized vacuolar protein YLR297W | |
Gene Name | YLR297W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 129 | |
Subcellular Localization |
Vacuole membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVEGDFVDEQSNIALLSSKSMCGDHHSVKNSIGDEIFKLLTKILNSDEKASGDVHTLVSGTPDLSNFNLDNEPLENILAVFIISFIIVVVGVLLLGLIGMIFISLRSGSSNDKKLQSNDEEKQALAEKA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL297_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL297_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL297_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GET3_YEAST | GET3 | physical | 18719252 | |
VAM7_YEAST | VAM7 | genetic | 27708008 | |
RV161_YEAST | RVS161 | genetic | 27708008 | |
SNX41_YEAST | SNX41 | genetic | 27708008 | |
RL29_YEAST | RPL29 | genetic | 27708008 | |
YBP2_YEAST | YBP2 | genetic | 27708008 | |
RSSA1_YEAST | RPS0A | genetic | 27708008 | |
YG51_YEAST | YGR237C | genetic | 27708008 | |
DOT5_YEAST | DOT5 | genetic | 27708008 | |
MEH1_YEAST | MEH1 | genetic | 27708008 | |
BRE2_YEAST | BRE2 | genetic | 27708008 | |
SIC1_YEAST | SIC1 | genetic | 27708008 | |
STM1_YEAST | STM1 | genetic | 27708008 | |
RS3A2_YEAST | RPS1B | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
GTR1_YEAST | GTR1 | genetic | 27708008 | |
RCO1_YEAST | RCO1 | genetic | 27708008 | |
RAD14_YEAST | RAD14 | genetic | 27708008 | |
PFKA2_YEAST | PFK2 | genetic | 27708008 | |
COX5A_YEAST | COX5A | genetic | 27708008 | |
MAS5_YEAST | YDJ1 | genetic | 27708008 | |
YO012_YEAST | YOR012W | genetic | 27708008 | |
CSK2C_YEAST | CKB2 | genetic | 27708008 | |
PALA_YEAST | RIM20 | genetic | 27708008 | |
HSP82_YEAST | HSP82 | genetic | 27708008 | |
TTC1_HUMAN | TTC1 | physical | 27107014 | |
SGTA_HUMAN | SGTA | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...