| UniProt ID | YC01A_YEAST | |
|---|---|---|
| UniProt AC | P87012 | |
| Protein Name | Putative pelota-like protein YCL001W-A | |
| Gene Name | YCL001W-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTFLQFINNNRQEGQGYISEKLFKTKKNEMIRKTVTNLVAVRLKNLSHEFDVIENYLRYIASTSEHLFTAIKRHFNKCARKLLKEAIDSKSNSETATVVLQEGFSGICLLKASSIILKLKLKFPKKKDRTDISKLCDKKERMTQWLEISILMN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YC01A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YC01A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YC01A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YC01A_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYIC_YEAST | ILS1 | genetic | 27708008 | |
| UBC3_YEAST | CDC34 | genetic | 27708008 | |
| TAF12_YEAST | TAF12 | genetic | 27708008 | |
| TBP_YEAST | SPT15 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| SWC4_YEAST | SWC4 | genetic | 27708008 | |
| SEC22_YEAST | SEC22 | genetic | 27708008 | |
| KPC1_YEAST | PKC1 | genetic | 27708008 | |
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| CDC53_YEAST | CDC53 | genetic | 27708008 | |
| NOP14_YEAST | NOP14 | genetic | 27708008 | |
| TFB1_YEAST | TFB1 | genetic | 27708008 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| SMT3_YEAST | SMT3 | genetic | 27708008 | |
| STT3_YEAST | STT3 | genetic | 27708008 | |
| NU145_YEAST | NUP145 | genetic | 27708008 | |
| CDC20_YEAST | CDC20 | genetic | 27708008 | |
| PAN1_YEAST | PAN1 | genetic | 27708008 | |
| DPOD2_YEAST | POL31 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| SMC4_YEAST | SMC4 | genetic | 27708008 | |
| RU1C_YEAST | YHC1 | genetic | 27708008 | |
| LCB1_YEAST | LCB1 | genetic | 27708008 | |
| CH10_YEAST | HSP10 | genetic | 27708008 | |
| UFE1_YEAST | UFE1 | genetic | 27708008 | |
| PROF_YEAST | PFY1 | genetic | 27708008 | |
| MYO2_YEAST | MYO2 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...