BZRD_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BZRD_YEAST
• UniProt AC: P40580
• Protein Name: Benzil reductase ((S)-benzoin forming) IRC24
• Gene Name: IRC24
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 263
• Protein Description: Reduces benzil stereospecifically to (S)-benzoin. Is probably involved in a pathway contributing to genomic integrity..
• Protein Sequence: MGKVILITGASRGIGLQLVKTVIEEDDECIVYGVARTEAGLQSLQREYGADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLEPVKSISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPFVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIRETLGPQGMTPKALERFTQLYKTSSLLDPKVPAAVLAQLVLKGIPDSLNGQYLRYNDERLGPVQG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
52	Acetylation	QREYGADKFVYRVLD HHHHCCCHHHEEHHH	35.87	24489116
95	Phosphorylation	GMLEPVKSISQSNSE CCCCCCHHHCCCCCH	27.92	30377154
99	Phosphorylation	PVKSISQSNSEHDIK CCHHHCCCCCHHHHH	35.22	30377154
106	Acetylation	SNSEHDIKQWERLFD CCCHHHHHHHHHHHC	56.25	24489116
179	Acetylation	ASEEPSDKVRAVCIA HCCCCCCCCEEEEEC	37.65	24489116
196	Acetylation	VVDTQMQKDIRETLG CCCHHHHHHHHHHHC	50.18	22865919
201	Phosphorylation	MQKDIRETLGPQGMT HHHHHHHHHCCCCCC	27.45	22369663
208	Phosphorylation	TLGPQGMTPKALERF HHCCCCCCHHHHHHH	28.58	22369663
210	Acetylation	GPQGMTPKALERFTQ CCCCCCHHHHHHHHH	57.34	25381059
220	Ubiquitination	ERFTQLYKTSSLLDP HHHHHHHHHHCCCCC	50.99	24961812
222	Phosphorylation	FTQLYKTSSLLDPKV HHHHHHHHCCCCCCC	18.16	30377154
223	Phosphorylation	TQLYKTSSLLDPKVP HHHHHHHCCCCCCCC	37.88	21440633

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BZRD_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BZRD_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BZRD_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BZRD_YEAST	IRC24	physical	18719252
BZRD_YEAST	IRC24	physical	22940862

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.