| UniProt ID | DCN1_YEAST | |
|---|---|---|
| UniProt AC | Q12395 | |
| Protein Name | Defective in cullin neddylation protein 1 | |
| Gene Name | DCN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 269 | |
| Subcellular Localization | ||
| Protein Description | Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with HRT1/RBX1 to recruit the Nedd8-charged E2 UBC12 to the cullin component of SCF-type complexes.. | |
| Protein Sequence | MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 12 | Phosphorylation | KIKRKDASPEQEAIE CCCCCCCCHHHHHHH | 38.82 | 21551504 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCN1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RUB1_YEAST | RUB1 | physical | 15988528 | |
| UBI4P_YEAST | UBI4 | physical | 15988528 | |
| CDC53_YEAST | CDC53 | physical | 15988528 | |
| DCN1_YEAST | DCN1 | physical | 18206966 | |
| CDC53_YEAST | CDC53 | physical | 18206966 | |
| UBC12_YEAST | UBC12 | physical | 18206966 | |
| SEH1_YEAST | SEH1 | genetic | 19061648 | |
| PRP19_YEAST | PRP19 | genetic | 19061648 | |
| CWC27_YEAST | CWC27 | genetic | 19061648 | |
| LAG2_YEAST | LAG2 | genetic | 19942853 | |
| CDC53_YEAST | CDC53 | physical | 20832729 | |
| RTG3_YEAST | RTG3 | genetic | 21127252 | |
| MET18_YEAST | MET18 | genetic | 21127252 | |
| KCS1_YEAST | KCS1 | genetic | 21127252 | |
| RPH1_YEAST | RPH1 | genetic | 21127252 | |
| CDC53_YEAST | CDC53 | physical | 19942853 | |
| LAG2_YEAST | LAG2 | physical | 19942853 | |
| UBC12_YEAST | UBC12 | physical | 19942853 | |
| UBC12_HUMAN | UBE2M | physical | 15988528 | |
| UBC12_YEAST | UBC12 | physical | 20832729 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. | |
