UniProt ID | DCN1_YEAST | |
---|---|---|
UniProt AC | Q12395 | |
Protein Name | Defective in cullin neddylation protein 1 | |
Gene Name | DCN1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 269 | |
Subcellular Localization | ||
Protein Description | Required for neddylation of cullin components of SCF-type E3 ubiquitin ligase complexes. Neddylation of cullins play an essential role in the regulation of SCF-type complexes activity. Does not act by preventing deneddylation, but rather facilitates neddylation, possibly by acting with HRT1/RBX1 to recruit the Nedd8-charged E2 UBC12 to the cullin component of SCF-type complexes.. | |
Protein Sequence | MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPVYPKELTQVFEHYINNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYWKLFFQPEYPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDETAAWPFIIDEFYECLQDQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | KIKRKDASPEQEAIE CCCCCCCCHHHHHHH | 38.82 | 21551504 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCN1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCN1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCN1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RUB1_YEAST | RUB1 | physical | 15988528 | |
UBI4P_YEAST | UBI4 | physical | 15988528 | |
CDC53_YEAST | CDC53 | physical | 15988528 | |
DCN1_YEAST | DCN1 | physical | 18206966 | |
CDC53_YEAST | CDC53 | physical | 18206966 | |
UBC12_YEAST | UBC12 | physical | 18206966 | |
SEH1_YEAST | SEH1 | genetic | 19061648 | |
PRP19_YEAST | PRP19 | genetic | 19061648 | |
CWC27_YEAST | CWC27 | genetic | 19061648 | |
LAG2_YEAST | LAG2 | genetic | 19942853 | |
CDC53_YEAST | CDC53 | physical | 20832729 | |
RTG3_YEAST | RTG3 | genetic | 21127252 | |
MET18_YEAST | MET18 | genetic | 21127252 | |
KCS1_YEAST | KCS1 | genetic | 21127252 | |
RPH1_YEAST | RPH1 | genetic | 21127252 | |
CDC53_YEAST | CDC53 | physical | 19942853 | |
LAG2_YEAST | LAG2 | physical | 19942853 | |
UBC12_YEAST | UBC12 | physical | 19942853 | |
UBC12_HUMAN | UBE2M | physical | 15988528 | |
UBC12_YEAST | UBC12 | physical | 20832729 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. | |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, AND MASSSPECTROMETRY. |