UniProt ID | YJX8_YEAST | |
---|---|---|
UniProt AC | P47085 | |
Protein Name | MEMO1 family protein YJR008W | |
Gene Name | YJR008W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 338 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSIRPATHAGSWYSNRAQELSQQLHTYLIKSTLKGPIHNARIIICPHAGYRYCGPTMAYSYASLDLNRNVKRIFILGPSHHIYFKNQILVSAFSELETPLGNLKVDTDLCKTLIQKEYPENGKKLFKPMDHDTDMAEHSLEMQLPMLVETLKWREISLDTVKVFPMMVSHNSVDVDRCIGNILSEYIKDPNNLFIVSSDFCHWGRRFQYTGYVGSKEELNDAIQEETEVEMLTARSKLSHHQVPIWQSIEIMDRYAMKTLSDTPNGERYDAWKQYLEITGNTICGEKPISVILSALSKIRDAGPSGIKFQWPNYSQSSHVTSIDDSSVSYASGYVTIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YJX8_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJX8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJX8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJX8_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ARP1_YEAST | ARP1 | physical | 11283351 | |
PLC1_YEAST | PLC1 | genetic | 22412880 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
ARP2_YEAST | ARP2 | genetic | 27708008 | |
COPA_YEAST | COP1 | genetic | 27708008 | |
TIM22_YEAST | TIM22 | genetic | 27708008 | |
CDC1_YEAST | CDC1 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
BET5_YEAST | BET5 | genetic | 27708008 | |
PRP24_YEAST | PRP24 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...