| UniProt ID | YJX8_YEAST | |
|---|---|---|
| UniProt AC | P47085 | |
| Protein Name | MEMO1 family protein YJR008W | |
| Gene Name | YJR008W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 338 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MSIRPATHAGSWYSNRAQELSQQLHTYLIKSTLKGPIHNARIIICPHAGYRYCGPTMAYSYASLDLNRNVKRIFILGPSHHIYFKNQILVSAFSELETPLGNLKVDTDLCKTLIQKEYPENGKKLFKPMDHDTDMAEHSLEMQLPMLVETLKWREISLDTVKVFPMMVSHNSVDVDRCIGNILSEYIKDPNNLFIVSSDFCHWGRRFQYTGYVGSKEELNDAIQEETEVEMLTARSKLSHHQVPIWQSIEIMDRYAMKTLSDTPNGERYDAWKQYLEITGNTICGEKPISVILSALSKIRDAGPSGIKFQWPNYSQSSHVTSIDDSSVSYASGYVTIG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YJX8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJX8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJX8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJX8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARP1_YEAST | ARP1 | physical | 11283351 | |
| PLC1_YEAST | PLC1 | genetic | 22412880 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| ARP2_YEAST | ARP2 | genetic | 27708008 | |
| COPA_YEAST | COP1 | genetic | 27708008 | |
| TIM22_YEAST | TIM22 | genetic | 27708008 | |
| CDC1_YEAST | CDC1 | genetic | 27708008 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| BET5_YEAST | BET5 | genetic | 27708008 | |
| PRP24_YEAST | PRP24 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...