YO163_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YO163_YEAST
• UniProt AC: P0CF20
• Protein Name: Putative uncharacterized transporter YOL163W
• Gene Name: YOL163W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 169
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MIAWSLVATLQCKMTGKSSFYTCRALMGLFEGGFVADLVLWMSYFYSSSELSIRLSFFWVTLSLTQIITSIVAFGVFHMRGIGGMAGWQWLFLIERIFTLVIGISAYFLMVPSVVQTKKPWSKKGWFTEREEKIIVNKILRDDPTKGDMNNRQGMSLKMLWQGITDYYI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Ubiquitination	ILRDDPTKGDMNNRQ HHCCCCCCCCCCCCC	59.30	22106047

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YO163_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YO163_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YO163_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PRP9_YEAST	PRP9	genetic	27708008
UAP1_YEAST	QRI1	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
RPN12_YEAST	RPN12	genetic	27708008
SWC4_YEAST	SWC4	genetic	27708008
DPOD2_YEAST	POL31	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.