UniProt ID | FCY1_YEAST | |
---|---|---|
UniProt AC | Q12178 | |
Protein Name | Cytosine deaminase | |
Gene Name | FCY1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 158 | |
Subcellular Localization | ||
Protein Description | Converts cytosine to uracil or 5-methylcytosine to thymine by deaminating carbon number 4.. | |
Protein Sequence | MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Acetylation | MASKWDQKGMDIAYE CCCCCCCCCCCHHHH | 54.45 | 24489116 | |
27 | Ubiquitination | EEAALGYKEGGVPIG HHHHHCCCCCCEEEC | 48.35 | 23749301 | |
41 | Ubiquitination | GGCLINNKDGSVLGR CCEEEECCCCCEECC | 60.00 | 23749301 | |
41 | Acetylation | GGCLINNKDGSVLGR CCEEEECCCCCEECC | 60.00 | 24489116 | |
56 | Ubiquitination | GHNMRFQKGSATLHG CCCCCCCCCCEEECC | 52.71 | 23749301 | |
56 | Acetylation | GHNMRFQKGSATLHG CCCCCCCCCCEEECC | 52.71 | 24489116 | |
77 | Acetylation | NCGRLEGKVYKDTTL CCCEEECEEECCCCC | 32.77 | 25381059 | |
120 | Acetylation | NFKSKGEKYLQTRGH CCCCCCCEEEECCCC | 60.99 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCY1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCY1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCY1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...