| UniProt ID | FCY1_YEAST | |
|---|---|---|
| UniProt AC | Q12178 | |
| Protein Name | Cytosine deaminase | |
| Gene Name | FCY1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 158 | |
| Subcellular Localization | ||
| Protein Description | Converts cytosine to uracil or 5-methylcytosine to thymine by deaminating carbon number 4.. | |
| Protein Sequence | MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 13 | Acetylation | MASKWDQKGMDIAYE CCCCCCCCCCCHHHH | 54.45 | 24489116 | |
| 27 | Ubiquitination | EEAALGYKEGGVPIG HHHHHCCCCCCEEEC | 48.35 | 23749301 | |
| 41 | Ubiquitination | GGCLINNKDGSVLGR CCEEEECCCCCEECC | 60.00 | 23749301 | |
| 41 | Acetylation | GGCLINNKDGSVLGR CCEEEECCCCCEECC | 60.00 | 24489116 | |
| 56 | Ubiquitination | GHNMRFQKGSATLHG CCCCCCCCCCEEECC | 52.71 | 23749301 | |
| 56 | Acetylation | GHNMRFQKGSATLHG CCCCCCCCCCEEECC | 52.71 | 24489116 | |
| 77 | Acetylation | NCGRLEGKVYKDTTL CCCEEECEEECCCCC | 32.77 | 25381059 | |
| 120 | Acetylation | NFKSKGEKYLQTRGH CCCCCCCEEEECCCC | 60.99 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FCY1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FCY1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FCY1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...