| UniProt ID | YKK7_YEAST | |
|---|---|---|
| UniProt AC | P34251 | |
| Protein Name | Uncharacterized oxidoreductase YKL107W | |
| Gene Name | YKL107W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 309 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MFWKKDPTVSWERKNINDIDFSRFNVAIIGGTGGLGRAISRELAQRNARVTVVGQTFRDEDLKDKINFVKADLSLVSECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRYTNIDTFGLNPGLIKTNIRNNLLGSDTYLSRITEWIISWTCQSAETYAKTICTLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRNQSPFTSSNE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKK7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKK7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKK7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| VMA21_YEAST | VMA21 | genetic | 27708008 | |
| DIF1_YEAST | DIF1 | genetic | 27708008 | |
| HMDH1_YEAST | HMG1 | genetic | 27708008 | |
| CGR1_YEAST | CGR1 | genetic | 27708008 | |
| VPS53_YEAST | VPS53 | genetic | 27708008 | |
| RL22A_YEAST | RPL22A | genetic | 27708008 | |
| VAM3_YEAST | VAM3 | genetic | 27708008 | |
| SFL1_YEAST | SFL1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...