YKK7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YKK7_YEAST
• UniProt AC: P34251
• Protein Name: Uncharacterized oxidoreductase YKL107W
• Gene Name: YKL107W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 309
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MFWKKDPTVSWERKNINDIDFSRFNVAIIGGTGGLGRAISRELAQRNARVTVVGQTFRDEDLKDKINFVKADLSLVSECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRYTNIDTFGLNPGLIKTNIRNNLLGSDTYLSRITEWIISWTCQSAETYAKTICTLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRNQSPFTSSNE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MFWKKDPTVSWERKN CCCCCCCCCCCCCCC	36.99	28889911
10	Phosphorylation	WKKDPTVSWERKNIN CCCCCCCCCCCCCCC	26.20	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YKK7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YKK7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YKK7_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
VMA21_YEAST	VMA21	genetic	27708008
DIF1_YEAST	DIF1	genetic	27708008
HMDH1_YEAST	HMG1	genetic	27708008
CGR1_YEAST	CGR1	genetic	27708008
VPS53_YEAST	VPS53	genetic	27708008
RL22A_YEAST	RPL22A	genetic	27708008
VAM3_YEAST	VAM3	genetic	27708008
SFL1_YEAST	SFL1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.