UniProt ID | YKK7_YEAST | |
---|---|---|
UniProt AC | P34251 | |
Protein Name | Uncharacterized oxidoreductase YKL107W | |
Gene Name | YKL107W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 309 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MFWKKDPTVSWERKNINDIDFSRFNVAIIGGTGGLGRAISRELAQRNARVTVVGQTFRDEDLKDKINFVKADLSLVSECKRISHSDEIPYEELTHLIFTTGIFASRQRQATSEGLEKDMAVSYLSRYIIFHDVAKRLGISRTKKDDLPKVFIAGFPGNGQVGDPDDLNSDEKKYSAYATHMNTVAANESLVIDAKDRYTNIDTFGLNPGLIKTNIRNNLLGSDTYLSRITEWIISWTCQSAETYAKTICTLIASPAIESRSGTMFSNKGDAILPSPGLTKDVVEKFMENSELLVEKALRNQSPFTSSNE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YKK7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YKK7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YKK7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VMA21_YEAST | VMA21 | genetic | 27708008 | |
DIF1_YEAST | DIF1 | genetic | 27708008 | |
HMDH1_YEAST | HMG1 | genetic | 27708008 | |
CGR1_YEAST | CGR1 | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
VAM3_YEAST | VAM3 | genetic | 27708008 | |
SFL1_YEAST | SFL1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...