dbPTM

CYPR_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CYPR_YEAST
UniProt AC	P25334
Protein Name	Peptidyl-prolyl cis-trans isomerase CPR4
Gene Name	CPR4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	318
Subcellular Localization	Membrane Single-pass membrane protein .
Protein Description	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides..
Protein Sequence	MWLKSLLLCLYSLVLCQVHAAPSSGKQITSKDVDLQKKYEPSPPATHRGIITIEYFDPVSKSMKEADLTFELYGTVVPKTVNNFAMLAHGVKAVIEGKDPNDIHTYSYRKTKINKVYPNKYIQGGVVAPDVGPFTVYGPKFDDENFYLKHDRPERLAMAYFGPDSNTSEFIITTKADGNEELDGKSVVFGQITSGLDQLMDAIQYTETDEYGKPQHELRFLYFVLEILKISNILDLHAAYTEKVEKFRNGDVSVGSTLENIFRNDKAYTPLTTSTGTTAYDLNHPISRALMCLTVLGLCFIAYKGMHEKPHTVSLRHK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
98	Ubiquitination	VKAVIEGKDPNDIHT EEEEECCCCCCCCCE	58.17	24961812
98	Acetylation	VKAVIEGKDPNDIHT EEEEECCCCCCCCCE	58.17	24489116
149	Ubiquitination	DDENFYLKHDRPERL CCCCEEECCCCHHHE	31.89	23749301
149	Acetylation	DDENFYLKHDRPERL CCCCEEECCCCHHHE	31.89	24489116
166	N-linked_Glycosylation	AYFGPDSNTSEFIIT EEECCCCCCCCEEEE	55.81	-
167	Phosphorylation	YFGPDSNTSEFIITT EECCCCCCCCEEEEE	33.32	27017623
168	Phosphorylation	FGPDSNTSEFIITTK ECCCCCCCCEEEEEC	34.46	27017623
246	Ubiquitination	AYTEKVEKFRNGDVS HHHHHHHHHCCCCCC	53.24	17644757
266	Ubiquitination	ENIFRNDKAYTPLTT HHHHCCCCCCCCEEC	47.01	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CYPR_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CYPR_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CYPR_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
OSTD_YEAST	SWP1	physical	18467557

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CYPR_YEAST

Related Literatures of Post-Translational Modification