UniProt ID | GPX1_YEAST | |
---|---|---|
UniProt AC | P36014 | |
Protein Name | Glutathione peroxidase-like peroxiredoxin 1 {ECO:0000305} | |
Gene Name | GPX1 {ECO:0000303|PubMed:10480913} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 167 | |
Subcellular Localization |
Peroxisome matrix . Mitochondrion outer membrane Peripheral membrane protein . |
|
Protein Description | Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. [PubMed: 10480913] | |
Protein Sequence | MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of GPX1_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FOLE_YEAST | MET7 | genetic | 21623372 | |
CY1_YEAST | CYT1 | genetic | 21623372 | |
GPX2_YEAST | GPX2 | genetic | 21282621 | |
GPX3_YEAST | HYR1 | genetic | 21282621 | |
GPX2_YEAST | GPX2 | genetic | 22659048 | |
GPX3_YEAST | HYR1 | genetic | 22659048 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
PRP19_YEAST | PRP19 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
TIM23_YEAST | TIM23 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...