| UniProt ID | GPX1_YEAST | |
|---|---|---|
| UniProt AC | P36014 | |
| Protein Name | Glutathione peroxidase-like peroxiredoxin 1 {ECO:0000305} | |
| Gene Name | GPX1 {ECO:0000303|PubMed:10480913} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 167 | |
| Subcellular Localization |
Peroxisome matrix . Mitochondrion outer membrane Peripheral membrane protein . |
|
| Protein Description | Glutathione peroxidase-like protein that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress. [PubMed: 10480913] | |
| Protein Sequence | MQEFYSFSPIDENGNPFPFNSLRNKVVLIVNVASHCAFTPQYKELEYLYEKYKSHGLVIVAFPCGQFGNQEFEKDKEINKFCQDKYGVTFPILHKIRCNGQKQDPVYKFLKNSVSGKSGIKMIKWNFEKFVVDRNGKVVKRFSCMTRPLELCPIIEELLNQPPEEQI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of GPX1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GPX1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GPX1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GPX1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FOLE_YEAST | MET7 | genetic | 21623372 | |
| CY1_YEAST | CYT1 | genetic | 21623372 | |
| GPX2_YEAST | GPX2 | genetic | 21282621 | |
| GPX3_YEAST | HYR1 | genetic | 21282621 | |
| GPX2_YEAST | GPX2 | genetic | 22659048 | |
| GPX3_YEAST | HYR1 | genetic | 22659048 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| SMD1_YEAST | SMD1 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| PRP19_YEAST | PRP19 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| MCM1_YEAST | MCM1 | genetic | 27708008 | |
| TIM23_YEAST | TIM23 | genetic | 27708008 | |
| SYA_YEAST | ALA1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
