| UniProt ID | PRP38_YEAST | |
|---|---|---|
| UniProt AC | Q00723 | |
| Protein Name | Pre-mRNA-splicing factor 38 | |
| Gene Name | PRP38 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 242 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Required for pre-mRNA splicing and maintenance of stable U6 small nuclear RNA levels. Implicated in the formation of stable and biologically active snRNP structures. As part of the U4/U6.U5 tri-snRNP particle, dispensible for spliceosome assembly, but required for conformational changes, which result in U4 snRNA release and the subsequent catalytic activation of the spliceosome.. | |
| Protein Sequence | MAVNEFQVESNISPKQLNNQSVSLVIPRLTRDKIHNSMYYKVNLSNESLRGNTMVELLKVMIGAFGTIKGQNGHLHMMVLGGIEFKCILMKLIEIRPNFQQLNFLLNVKNENGFDSKYIIALLLVYARLQYYYLNGNNKNDDDENDLIKLFKVQLYKYSQHYFKLKSFPLQVDCFAHSYNEELCIIHIDELVDWLATQDHIWGIPLGKCQWNKIYNSDEESSSSESESNGDSEDDNDTSSES | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PRP38_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRP38_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRP38_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRP38_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
