UniProt ID | YBU6_YEAST | |
---|---|---|
UniProt AC | P38256 | |
Protein Name | Uncharacterized protein YBR096W | |
Gene Name | YBR096W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 230 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MGVCTIFRWLFAAYLLSSYKSLPGAYFVRFYYYVIQNLFLPMFTGFETENIKKLEKNEYGCFSYTSLDTYASPFECDFYFHKSNSTYFAELDISRGNLMCKIFQKLMLNSKHYPYIPVANVFTNFLKEIKPFQKYSVSSRIICWDEKWIYVMSRFTIKKGTVLCSLSLTKYVLKDGRKTIKPKDALEYCGLYNEKVAKISEDNLKLLTERCGFHETVPLENLSQEYCSEI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
87 | Phosphorylation | FHKSNSTYFAELDIS EECCCCCEEEEEEEC | 10.70 | 24930733 | |
111 | Acetylation | QKLMLNSKHYPYIPV HHHHHCCCCCCCCCH | 46.19 | 24489116 | |
130 | Acetylation | TNFLKEIKPFQKYSV HHHHHHCCCCCCCCC | 40.65 | 24489116 | |
134 | Acetylation | KEIKPFQKYSVSSRI HHCCCCCCCCCCCEE | 39.61 | 24489116 | |
181 | Acetylation | KDGRKTIKPKDALEY CCCCCCCCHHHHHHH | 51.77 | 24489116 | |
205 | Acetylation | KISEDNLKLLTERCG ECCHHHHHHHHHHHC | 47.94 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBU6_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBU6_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBU6_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...