| UniProt ID | CBS1_YEAST | |
|---|---|---|
| UniProt AC | P14066 | |
| Protein Name | Cytochrome b translational activator protein CBS1, mitochondrial | |
| Gene Name | CBS1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 229 | |
| Subcellular Localization |
Mitochondrion inner membrane Peripheral membrane protein . |
|
| Protein Description | mRNA-specific translational activator of cytochrome b. The cytochrome b (COB) leader RNA may represent the target sequence for CBS1 and CBS2, tethering the COB mRNA to the inner mitochondrial membrane, where cotranslational insertion of cytochrome b into the membrane can occur.. | |
| Protein Sequence | MLRTKVFATTVARISGIRRYIPIRTINTVTKKNISKIEKLCEVLEVNPDGYKGKERIPTKELTKLLYTTSRNMLVRVPMTGDLSTGNTFETRNETLQKLGEQLIHLEINKMLTITFTNFNQFNIMNKNFNYIHNLDRARVVNMDSISWLIKNSLKINQLAHLRIPANLPKEMGLTSSSNDFQNLNDWKVILSFIGYLKLLEIKNDNKKFIESIIKTICIPLINYHLRKS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 113 | Phosphorylation | LEINKMLTITFTNFN HHHHCCEEEEEECCH | 17.93 | 29136822 | |
| 115 | Phosphorylation | INKMLTITFTNFNQF HHCCEEEEEECCHHH | 21.12 | 29136822 | |
| 117 | Phosphorylation | KMLTITFTNFNQFNI CCEEEEEECCHHHCC | 30.19 | 29136822 | |
| 151 | Acetylation | DSISWLIKNSLKINQ HHHHHHHHCCCCCCC | 38.01 | 25381059 | |
| 192 | Phosphorylation | NDWKVILSFIGYLKL CCHHHHHHHHHHHHH | 12.05 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CBS1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBS1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBS1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
