UniProt ID | TDA8_YEAST | |
---|---|---|
UniProt AC | Q6B2U8 | |
Protein Name | Topoisomerase I damage affected protein 8 | |
Gene Name | TDA8 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 126 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MTGYFLPPQTSSYTFRFAKVDDSAILSVGGDVAFGCCAQEQPPITSTNFTINGIKPWQGRLPDNIAGTVYMYAGFYCPMKIVYSNAVSWHTLPVSVELPDVTTVSDDFAGHVYSFDDDLTAQLYYP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of TDA8_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TDA8_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TDA8_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TDA8_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
STU1_YEAST | STU1 | genetic | 27708008 | |
MED8_YEAST | MED8 | genetic | 27708008 | |
CDC10_YEAST | CDC10 | genetic | 27708008 | |
ERF3_YEAST | SUP35 | genetic | 27708008 | |
SMT3_YEAST | SMT3 | genetic | 27708008 | |
PSB3_YEAST | PUP3 | genetic | 27708008 | |
RSP5_YEAST | RSP5 | genetic | 27708008 | |
GNA1_YEAST | GNA1 | genetic | 27708008 | |
MPPA_YEAST | MAS2 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
GPI16_YEAST | GPI16 | genetic | 27708008 | |
NMT_YEAST | NMT1 | genetic | 27708008 | |
CDC3_YEAST | CDC3 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
RPC6_YEAST | RPC34 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
NIP7_YEAST | NIP7 | genetic | 27708008 | |
DIB1_YEAST | DIB1 | genetic | 27708008 | |
BUR1_YEAST | SGV1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...