| UniProt ID | TDA8_YEAST | |
|---|---|---|
| UniProt AC | Q6B2U8 | |
| Protein Name | Topoisomerase I damage affected protein 8 | |
| Gene Name | TDA8 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 126 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MTGYFLPPQTSSYTFRFAKVDDSAILSVGGDVAFGCCAQEQPPITSTNFTINGIKPWQGRLPDNIAGTVYMYAGFYCPMKIVYSNAVSWHTLPVSVELPDVTTVSDDFAGHVYSFDDDLTAQLYYP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of TDA8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TDA8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TDA8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TDA8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| STU1_YEAST | STU1 | genetic | 27708008 | |
| MED8_YEAST | MED8 | genetic | 27708008 | |
| CDC10_YEAST | CDC10 | genetic | 27708008 | |
| ERF3_YEAST | SUP35 | genetic | 27708008 | |
| SMT3_YEAST | SMT3 | genetic | 27708008 | |
| PSB3_YEAST | PUP3 | genetic | 27708008 | |
| RSP5_YEAST | RSP5 | genetic | 27708008 | |
| GNA1_YEAST | GNA1 | genetic | 27708008 | |
| MPPA_YEAST | MAS2 | genetic | 27708008 | |
| MED6_YEAST | MED6 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| GPI16_YEAST | GPI16 | genetic | 27708008 | |
| NMT_YEAST | NMT1 | genetic | 27708008 | |
| CDC3_YEAST | CDC3 | genetic | 27708008 | |
| AFG2_YEAST | AFG2 | genetic | 27708008 | |
| RPC6_YEAST | RPC34 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| NIP7_YEAST | NIP7 | genetic | 27708008 | |
| DIB1_YEAST | DIB1 | genetic | 27708008 | |
| BUR1_YEAST | SGV1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...