UniProt ID | YBR2_YEAST | |
---|---|---|
UniProt AC | P38239 | |
Protein Name | Uncharacterized RING finger protein YBR062C | |
Gene Name | YBR062C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 180 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSTYEEEHGIQQNSRDYQEVGGTSQEEQRRQVRSQLQGLFQNFGNTSGEGDAHSDSTLLLRLLSQMLPESLQEEWLQEMDKGKSAGCPDTFAASLPRINKKKLKATDNCSICYTNYLEDEYPLVVELPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHRIINEIDTTEAELEEDWGMYG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSTYEEEHG ------CCCHHHHHC | 39.43 | 22814378 | |
23 | Phosphorylation | DYQEVGGTSQEEQRR CHHHHCCCCHHHHHH | 22.70 | 27214570 | |
24 | Phosphorylation | YQEVGGTSQEEQRRQ HHHHCCCCHHHHHHH | 38.58 | 27017623 | |
56 | Phosphorylation | EGDAHSDSTLLLRLL CCCCCCHHHHHHHHH | 24.78 | 17563356 | |
83 | Ubiquitination | LQEMDKGKSAGCPDT HHHHHCCCCCCCCHH | 42.76 | 17644757 | |
90 | Phosphorylation | KSAGCPDTFAASLPR CCCCCCHHHHHHCCC | 10.58 | 28889911 | |
94 | Phosphorylation | CPDTFAASLPRINKK CCHHHHHHCCCCCCC | 35.16 | 28889911 | |
133 | Ubiquitination | ELPHCHHKFDLECLS ECCCCCCCCCHHHHH | 19.53 | 17644757 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBR2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBR2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBR2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ADH3_YEAST | ADH3 | physical | 16554755 | |
GLE1_YEAST | GLE1 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
CDC1_YEAST | CDC1 | genetic | 27708008 | |
PSB3_YEAST | PUP3 | genetic | 27708008 | |
PSB7_YEAST | PRE4 | genetic | 27708008 | |
YIP1_YEAST | YIP1 | genetic | 27708008 | |
TAF1_YEAST | TAF1 | genetic | 27708008 | |
BRL1_YEAST | BRL1 | genetic | 27708008 | |
MED6_YEAST | MED6 | genetic | 27708008 | |
STS1_YEAST | STS1 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
GSP1_YEAST | GSP1 | genetic | 27708008 | |
CDC25_YEAST | CDC25 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
PSB2_YEAST | PUP1 | genetic | 27708008 | |
RRS1_YEAST | RRS1 | genetic | 27708008 | |
IF6_YEAST | TIF6 | genetic | 27708008 | |
PSB5_YEAST | PRE2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-56, AND MASSSPECTROMETRY. |