| UniProt ID | MRX8_YEAST | |
|---|---|---|
| UniProt AC | Q05473 | |
| Protein Name | MIOREX complex component 8 {ECO:0000305|PubMed:25683707} | |
| Gene Name | MRX8 {ECO:0000303|PubMed:25683707} | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 314 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Component of MIOREX complexes, large expressome-like assemblies of ribosomes with factors involved in all the steps of post-transcriptional gene expression.. | |
| Protein Sequence | MEQLCKRYVHTPAAFIQNIVANTKRTTLATQLSVEKAKKKVPKTALKKKLNSRPKERLPNWLKLNDVFNIHYEKPSNSDINKVNRFFNKAKVEFEWCAASFDDIPENPFLNKKSHKDILKDHGECGTTLIDTLPEVIFLGGTNVGKSSILNNITTSHVSRDLGSLARVSKTTGFTKTLNCYNVGNRLRMIDSPGYGFNSSKEQGKVTLQYLLERKQLVRCFLLLAGDKEINNTDNMIIQYIHEHGVPFEVVFTKMDKVKDLNKFKKKVMSSGLMDLPTLPRLVLTNSLTSSTSPKRFGIDLLRYVIFQSCGLIL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 192 | Phosphorylation | NRLRMIDSPGYGFNS CEEEEECCCCCCCCC | 29734811 | ||
| 195 | Phosphorylation | RMIDSPGYGFNSSKE EEECCCCCCCCCCCC | 29734811 | ||
| 271 | Phosphorylation | FKKKVMSSGLMDLPT HHHHHHHCCCCCCCC | 25521595 | ||
| 278 | Phosphorylation | SGLMDLPTLPRLVLT CCCCCCCCCCEEEEC | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MRX8_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MRX8_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MRX8_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PET20_YEAST | PET20 | genetic | 27708008 | |
| CALM_YEAST | CMD1 | genetic | 27708008 | |
| RPAB1_YEAST | RPB5 | genetic | 27708008 | |
| PDC2_YEAST | PDC2 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| SEN1_YEAST | SEN1 | genetic | 27708008 | |
| MED11_YEAST | MED11 | genetic | 27708008 | |
| LST8_YEAST | LST8 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| SNF5_YEAST | SNF5 | genetic | 27708008 | |
| SNF6_YEAST | SNF6 | genetic | 27708008 | |
| SDS3_YEAST | SDS3 | genetic | 27708008 | |
| PTK2_YEAST | PTK2 | genetic | 27708008 | |
| IXR1_YEAST | IXR1 | genetic | 27708008 | |
| RM39_YEAST | MRPL39 | genetic | 27708008 | |
| SAP30_YEAST | SAP30 | genetic | 27708008 | |
| PHO23_YEAST | PHO23 | genetic | 27708008 | |
| LSM7_YEAST | LSM7 | genetic | 27708008 | |
| SIN3_YEAST | SIN3 | genetic | 27708008 | |
| DNLI4_YEAST | DNL4 | genetic | 27708008 | |
| WHI5_YEAST | WHI5 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
